Loading...
The URL can be used to link to this page
Your browser does not support the video tag.
Home
My WebLink
About
Simpson Sandblasting & Special Coatings, Inc; 2026-03-18; PWS26-3918UTIL
Revised 6/12/18 Contract No. 5024-3A Page 1 of 117 CARLSBAD MUNICIPAL WATER DISTRICT San Diego County California CONTRACT DOCUMENTS, GENERAL PROVISIONS AND TECHNICAL SPECIFICATIONS FOR WATER RESERVOIR IMPROVEMENT PROGRAM ELM AND SKYLINE STEEL RESERVOIR COATING PROJECT PROJECT NO. 5024-3A BID NO. PWS26-3918UTIL Signed: 9/30/2025 Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 Revised 6/12/18 Contract No. 5024-3A Page 2 of 117 TABLE OF CONTENTS Item Page Notice Inviting Bids ..................................................................................................................... 6 Contractor's Proposal ................................................................................................................ 13 Bid Security Form ..................................................................................................................... 18 Bidder’s Bond to Accompany Proposal ..................................................................................... 19 Guide for Completing the “Designation of Subcontractors” Form .............................................. 20 Designation of Subcontractor and Amount of Subcontractor’s Bid Items .................................. 22 Bidder's Statement of Technical Ability and Experience ............................................................ 23 Bidder’s Certificate of Insurance for General Liability, Employers’ Liability, Automotive Liability and Workers’ Compensation ........................................................................................ 24 Bidder’s Statement Re Debarment ............................................................................................ 25 Bidder's Disclosure of Discipline Record …………………………………………… ...................... 26 Noncollusion Declaration to Be Executed by Bidder and Submitted with Bid ............................. 28 Contract Public Works ............................................................................................................... 29 Labor and Materials Bond ......................................................................................................... 36 Faithful Performance/Warranty Bond ........................................................................................ 38 Optional Escrow Agreement for Surety Deposits in Lieu of Retention ....................................... 40 Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 Revised 6/12/18 Contract No. 5024-3A Page 3 of 117 GENERAL PROVISIONS Section 1 Terms, Definitions Abbreviations and Symbols 1-1 Terms .......................................................... ..................................................... 43 1-2 Definitions .................................................... ..................................................... 43 1-3 Abbreviations ............................................... ..................................................... 49 1-4 Units of Measure .......................................... ..................................................... 52 1-5 Symbols ....................................................... ..................................................... 53 Section 2 Scope and Control of The Work 2-1 Award and Execution of Contract ................. ..................................................... 54 2-2 Assignment .................................................. ..................................................... 54 2-3 Subcontracts ................................................ ..................................................... 54 2-4 Contract Bonds ............................................ ..................................................... 55 2-5 Plans and Specifications .............................. ..................................................... 56 2-6 Work to be Done .......................................... ..................................................... 61 2-7 Subsurface Data .......................................... ..................................................... 61 2-8 Right-of-Way ................................................ ..................................................... 61 2-9 Surveying ..................................................... ..................................................... 62 2-10 Authority of Board and Engineer .................. ..................................................... 63 2-11 Inspection .................................................... ..................................................... 64 Section 3 Changes in Work 3-1 Changes Requested by the Contractor ........ ..................................................... 65 3-2 Changes Initiated by the Agency .................. ..................................................... 65 3-3 Extra Work ................................................... ..................................................... 66 3-4 Changed Conditions .................................... ..................................................... 69 3-5 Disputed Work ............................................. ..................................................... 70 Section 4 Control of Materials 4-1 Materials and Workmanship ......................... ..................................................... 76 4-2 Materials Transportation, Handling and Storage ................................................ 80 Section 5 Utilities 5-1 Location ....................................................... ..................................................... 81 5-2 Protection .................................................... ..................................................... 81 5-3 Removal ...................................................... ..................................................... 82 5-4 Relocation .................................................... ..................................................... 82 5-5 Delays .......................................................... ..................................................... 83 5-6 Cooperation ................................................. ..................................................... 83 Section 6 Prosecution, Progress and Acceptance of the Work 6-1 Construction Schedule and Commencement of Work ........................................ 84 6-2 Prosecution of Work ..................................... ..................................................... 86 6-3 Suspension of Work ..................................... ..................................................... 87 6-4 Default by Contractor ................................... ..................................................... 88 6-5 Termination of Contract................................ ..................................................... 88 6-6 Delays and Extensions of Time .................... ..................................................... 88 6-7 Time of Completion ...................................... ..................................................... 89 6-8 Completion, Acceptance, and Warranty ....... ..................................................... 90 6-9 Liquidated Damages .................................... ..................................................... 92 Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 Revised 6/12/18 Contract No. 5024-3A Page 4 of 117 6-10 Use of Improvement During Construction .... ..................................................... 92 Section 7 Responsibilities of the Contractor 7-1 Contractor’s Equipment and Facilities .......... ..................................................... 93 7-2 Labor ........................................................... ..................................................... 93 7-3 Liability Insurance ........................................ ..................................................... 93 7-4 Workers' Compensation Insurance .............. ..................................................... 93 7-5 Permits ........................................................ ..................................................... 94 7-6 The Contractor’s Representative .................. ..................................................... 95 7-7 Cooperation and Collateral Work ................. ..................................................... 96 7-8 Project Site Maintenance ............................. ..................................................... 96 7-9 Protection and Restoration of Existing Improvements ........................................ 99 7-10 Public Convenience and Safety ................... ................................................... 100 7-11 Patent Fees or Royalties .............................. ................................................... 107 7-12 Advertising ................................................... ................................................... 108 7-13 Laws to be Observed ................................... ................................................... 108 7-14 Antitrust Claims ............................................ ................................................... 108 Section 8 Facilities for Agency Personnel 8-1 General ........................................................ ................................................... 109 Section 9 Measurement and Payment 9-1 Measurement of Quantities for Unit Price Work ............................................... 110 9-2 Lump Sum Work .......................................... ................................................... 110 9-3 Payment ...................................................... ................................................... 110 9-4 Bid Items ...................................................... ................................................... 114 TECHNICAL SPECIFICAITONS 003119 Existing condition information 028319 Lead based paint remediation 028333 Lead based paint removal and disposal 099713 Steel water storage tank coating APPENDICES Appendix A Location Maps and Tank Attributes Appendix B Tank Photos Appendix C Utility Shutdown Request, E-28 Form Appendix D Detail Sheet Appendix E Reservoir Record Drawings Appendix F CARB Fleet Compliance Certification Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 Revised 6/12/18 Contract No. 5024-3A Page 5 of 117 CARLSBAD MUNICIPAL WATER DISTRICT, CALIFORNIA NOTICE INVITING BIDS Until 11 a.m. on November 5, 2025, the Carlsbad Municipal Water District shall accept bids via electronic format via the City of Carlsbad Electronic Bidding Site, PlanetBids, which may be accessed at https://www.carlsbadca.gov/departments/finance/contracting-purchasing, for providing all labor, materials, tools, equipment, and services to replace the interior and exterior coating systems and construct associated sanitary and safety improvements at the following potable water tanks: - Elm Tank 1.5 Million Gallon capacity, Shell Height: 22.5-ft, Shell Diameter: 106-ft Adjacent to 3151 Donna Drive, Carlsbad CA 92008 - Skyline Tank 1.5 Million Gallon capacity, Shell Height: 22.5-ft, Shell Diameter: 106-ft Adjacent to 4275 Skyline Road, Carlsbad CA 92008 WATER RESERVOIR IMPROVEMENT PROGAM ELM AND SKYLINE STEEL RESERVOIR COATING PROJECT PROJECT NO. 5024-3A PWS26-3918UTIL ELECTRONIC FORMAT RECEIPT AND OPENING OF BIDS: Bids will be received in electronic format (eBids) EXCLUSIVELY at the City of Carlsbad’s electronic bidding (eBidding) site, at: Contracting & Purchasing | Carlsbad, CA (carlsbadca.gov) and are due by the date and time shown on the cover of this solicitation. BIDDERS MUST BE PRE-REGISTERED with the City’s bidding system and possess a system-assigned Digital ID in order to submit an electronic bid. The City’s electronic bidding (eBidding) system will automatically track information submitted to the site including IP addresses, browsers being used and the URLs from which information was submitted. In addition, the City’s bidding system will keep a history of every login instance including the time of login, and other information about the user's computer configuration such as the operating system, browser type, version, and more. Because of these security features, Bidders who disable their browsers’ cookies will not be able to log in and use the City’s bidding system. The City’s electronic bidding system is responsible for bid tabulations. Upon the bidder’s or proposer’s entry of their bid, the system will ensure that all required fields are entered. The system will not accept a bid for which any required information is missing. This includes all necessary pricing, subcontractor listing(s) and any other essential documentation and supporting materials and forms requested or contained in these solicitation documents. BIDS REMAIN SEALED UNTIL DUE DATE AND TIME eBids are transmitted into the City’s bidding system via hypertext transfer protocol secure (https) mechanism using SSL 128-256-bit security certificates issued from Verisign/Thawte which encrypts data being transferred from client to server. Bids submitted prior to the Due Date and Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 Revised 6/12/18 Contract No. 5024-3A Page 6 of 117 Time are not available for review by anyone other than the submitter, who will have until the Due Date and Time to change, rescind or retrieve its bid should they desire to do so. BIDS MUST BE SUBMITTED BY DUE DATE AND TIME Once the deadline is reached, no further submissions are accepted into the system. Once the Due Date and Time has passed, bidders, proposers, the general public, and City staff are able to immediately see the results online. City staff may then begin reviewing the submissions for responsiveness, compliance and other issues. RECAPITULATION OF THE WORK Bids shall not contain any recapitulation of the Work. Conditional Bids may be rejected as being non-responsive. Alternative proposals will not be considered unless called for. BIDS MAY BE WITHDRAWN by the Bidder prior to, but not after, the time set as Due Date and Time. Important Note: Submission of the electronic bid into the system may not be instantaneous. Due to the speed and capabilities of the user’s internet service provider (ISP), bandwidth, computer hardware and other variables, it may take time for the bidder’s submission to upload and be received by the City’s eBidding system. It is the bidder’s sole responsibility to ensure their bids are received on time by the City’s eBidding system. The City of Carlsbad is not responsible for bids that do not arrive by the Due Date and Time. ELECTRONIC SUBMISSIONS CARRY FULL FORCE AND EFFECT The Bidder, by submitting their electronic proposal, agrees to and certifies under penalty of perjury under the laws of the State of California, that the certification, forms and affidavits submitted as part of this proposal are true and correct. The bidder, by submitting its electronic bid, acknowledges that doing so carries the same force and full legal effect as a paper submission with a longhand (wet) signature. By submitting an electronic bid, the bidder certifies that the bidder has thoroughly examined and understands the entire Contract Documents (which consist of the plans and specifications, drawings, forms, affidavits and the solicitation documents), and that by submitting the eBid as its bid proposal, the bidder acknowledges, agrees to and is bound by the entire Contract Documents, including any addenda issued thereto, and incorporated by reference in the Contract Documents. BIDS ARE PUBLIC RECORDS Upon receipt by the City, bids shall become public records subject to public disclosure. It is the responsibility of the Bidder to clearly identify any confidential, proprietary, trade secret or otherwise legally privileged information contained within the proposal’s General references to sections of the California Public Records Act (PRA) will not suffice. If the Bidder does not provide applicable case law that clearly establishes that the requested information is exempt from the disclosure requirements of the PRA, the City shall be free to release the information when required in accordance with the PRA, pursuant to any other applicable law, or by order of any court or government agency, and the Bidder agrees to hold the City harmless for any such release of this information. INSTRUCTIONS TO BIDDERS AND BID REQUIREMENTS There are multiple bid schedules for the Work of this Contract and the Bidder shall complete all Bid Schedules for the bid to be deemed responsive. The Agency shall determine the low Bid as described in the Contractor’s Proposal form. Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 Revised 6/12/18 Contract No. 5024-3A Page 7 of 117 This bid and the terms of the Contract Documents and General Provisions constitute an irrevocable offer that shall remain valid and in full force for a period of 90 days and such additional time as may be mutually agreed upon by the Carlsbad Municipal Water District and the Bidder. This bid and the terms of the Contract Documents and General Provisions constitute an irrevocable offer that shall remain valid and in full force for a period of 90 days and such additional time as may be mutually agreed upon by Carlsbad Municipal Water District and the Bidder. No bid will be received unless it is made on a proposal form furnished by the Purchasing Department. Each bid must be accompanied by security in a form and amount required by law. The bidder's security of the second and third next lowest responsive bidders may be withheld until the Contract has been fully executed. The security submitted by all other unsuccessful bidders shall be returned to them, or deemed void, within ten (10) days after the Contract is awarded. Pursuant to the provisions of law (Public Contract Code section 10263), appropriate securities may be substituted for any obligation required by this notice or for any monies withheld by the District to ensure performance under this Contract. Section 10263 of the Public Contract Code requires monies or securities to be deposited with the District or a state or federally chartered bank in California as the escrow agent. The escrow agent shall maintain insurance to cover negligent acts and omissions of the agent in connection with the handling of retentions under this section in an amount not less than $100,000 per contract. The Carlsbad Municipal Water District may disqualify a contractor or subcontractor from participating in bidding when a contractor or subcontractor has been debarred by the City of Carlsbad or another jurisdiction in the State of California as an irresponsible bidder. The work shall be performed in strict conformity with the plans, provisions, and specifications as approved by the City Council of the City of Carlsbad on file with the City Clerk’s Office. The specifications for the work include City of Carlsbad Engineering Standards and the Standard Specifications for Public Works Construction all hereinafter designated “SSPWC”, as amended. Specification Reference is hereby made to the plans and specifications for full particulars and description of the work. The General Provisions (Part 1) to the SSPWC do not apply. The Carlsbad Municipal Water District encourages the participation of minority and women- owned businesses. The Carlsbad Municipal Water District encourages all bidders, suppliers, manufacturers, fabricators and contractors to utilize recycled and recyclable materials when available, appropriate and approved by the Engineer. BID DOCUMENTS The bid documents comprise the following documents which must be completed and properly executed including notarization, where indicated. 1. Contractor's Proposal 2. Bidder's Bond (at time of Bid submit PDF copy via PlanetBids / All Bidders). Bid Bond (Original) within two (2) business days of bid Opening / three (3) Apparent Low Bidders. 3. Noncollusion Declaration 4. Designation of Subcontractor and Amount of Subcontractor’s Bid 5. Bidder's Statement of Technical Ability and Experience Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 Revised 6/12/18 Contract No. 5024-3A Page 8 of 117 6. Acknowledgement of Addendum(a) 7. Certificate of Insurance. The riders covering the City, its officials, employees and volunteers may be omitted at the time of bid submittal but shall be provided by the Bidder prior to award of this contract. 8. Bidder’s Statement Re Debarment 9. Bidder's Disclosure of Discipline Record 10. CARB Fleet Compliance Certification (Appendix F) 11. Escrow Agreement for Security Deposits - (optional, must be completed if the Bidder wishes to use the Escrow Agreement for Security) BIDDER’S GUARANTEE OF GOOD FAITH (BID SECURITY) At the time of bid submission, bidders must upload d submit an electronic PDF copy of the aforementioned bid security. Whether in the form of a cashier's check, a properly certified check or an approved corporate surety bond payable to the City of Carlsbad, the bid security must be uploaded to the Carlsbad Municipal Water District’s eBidding system. Within two (2) business days after the bid opening date, the first three (3) apparent low bidders must provide CMWD with the original bid security. Failure to submit the electronic version of the bid security at time of bid submission shall cause the bid to be rejected and deemed non-responsive. Only the three (3) apparent low bidders are required to submit original bid security to CMWD within two (2) business days after bid opening date. Failure to provide the original within two (2) business days may deem the bidder non- responsive. ENGINEER’S ESTIMATE All bids will be compared on the basis of the Engineer's Estimate. The estimated quantities are approximate and serve solely as a basis for the comparison of bids. The Engineer's Estimate is $2,135,000. TIME OF COMPLETION The Contractor shall complete the Work within the time set in the contract as defined in the General Provisions Section 6-7. SPECIALTY CONTRACTORS: ACCEPTABLE LICENSE TYPES Except as provided herein a bid submitted to the City by a Contractor who is not licensed as a contractor pursuant to the Business and Professions Code shall be considered nonresponsive and shall be rejected by the City. In all contracts where federal funds are involved, no bid submitted shall be invalidated by the failure of the bidder to be licensed in accordance with California law. Where federal funds are involved the contractor shall be properly licensed at the time the contract is awarded. In all other cases the contractor shall state their license number, expiration date and classification in the proposal, under penalty of perjury. This invitation to bid does not use federal funds. The following classifications are acceptable for this contract: C33 – Painting and Decorating. ESCROW AGREEMENT If the Contractor intends to utilize the escrow agreement included in the contract documents in lieu of the usual 5% retention from each payment, these documents must be completed and submitted with the signed contract. The escrow agreement may not be substituted at a later date. Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 Revised 6/12/18 Contract No. 5024-3A Page 9 of 117 OBTAINING PLANS AND SPECIFICATIONS Sets of plans, various supplemental provisions, and Contract documents may be obtained from the City of Carlsbad website at https://www.carlsbadca.gov/departments/finance/contracting- purchasing Paper copies will not be sold. INTENT OF PLANS AND SPECIFICATIONS Any prospective bidder who is in doubt as to the intended meaning of any part of the drawings, specifications or other contract documents, or finds discrepancies in or omissions from the drawings and specifications may submit to the Engineer a written request for clarification or correction. Any response will be made only by a written addendum duly issued by the Engineer a copy of which will be mailed or delivered to each person receiving a set of the contract documents. No oral response will be made to such inquiry. Prior to the award of the contract, no addition to, modification of or interpretation of any provision in the contract documents will be given by any agent, employee or contractor of the Carlsbad Municipal Water District as hereinbefore specified. No bidder may rely on directions given by any agent, employee or contractor of the Carlsbad Municipal Water District except as hereinbefore specified. BIDDER’S INQUIRIES Questions on the bid documents during the bid period shall be submitted in writing, via the eBidding website. Questions shall be definite and certain and shall reference applicable drawing sheets, notes, details or specification sheets. The deadline to submit questions is October 24, 2025, at 5 p.m. No questions will be entertained after that date. The answers to questions submitted during the bidding period will be published in an addendum and provided to those bidding on the project no later than October 30, 2025. REJECTION OF BIDS The City of Carlsbad reserves the right to reject any or all bids and to waive any minor irregularity or informality in such bids. PREVAILING WAGE TO BE PAID The general prevailing rate of wages for each craft or type of worker needed to execute the Contract shall be those as determined by the Director of Industrial Relations pursuant to the sections 1770, 1773, and 1773.1 of the Labor Code. Pursuant to section 1773.2 of the Labor Code, a current copy of applicable wage rates is on file in the Office of the City Engineer. The Contractor to whom the Contract is awarded shall not pay less than the said specified prevailing rates of wages to all workers employed by him or her in the execution of the Contract. The Prime Contractor shall be responsible for insuring compliance with provisions of section 1777.5 of the Labor Code and section 4100 et seq. of the Public Contracts Code, "Subletting and Subcontracting Fair Practices Act." The City Engineer is the City’s "duly authorized officer" for the purposes of section 4107 and 4107.5. The provisions of Part 7, Chapter 1, of the Labor Code commencing with section 1720 shall apply to the Contract for work. Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 Revised 6/12/18 Contract No. 5024-3A Page 10 of 117 A contractor or subcontractor shall not be qualified to bid on, be listed in a bid proposal, subject to the requirements of Section 4104 of the Public Contract Code or engage in the performance of any contract for public work, unless currently registered and qualified to perform public work pursuant to Section 1725.5. This project is subject to compliance monitoring and enforcement by the Department of Industrial Relations. The Prime Contractor and all subcontractors shall comply with Section 1776 of the Labor Code, which generally requires keeping accurate payroll records, verifying and certifying payroll records, and making them available for inspection. Contractor shall require all subcontractors to comply with Section 1776. CALIFORNIA AIR RESOURCES BOARD (CARB) ADVANCED CLEAN FLEETS REGULATIONS Contractor’s vehicles with a gross vehicle weight rating greater than 8,500 lbs. and light-duty package delivery vehicles operated in California may be subject to the California Air Resources Board (CARB) Advanced Clean Fleets regulations. Such vehicles may therefore be subject to requirements to reduce emissions of air pollutants. For more information, please see Appendix A and visit the CARB Advanced Clean Fleets webpage at https://ww2.arb.ca.gov/our- work/programs/advanced-clean-fleets. MANDATORY PRE-BID MEETING A mandatory pre-bid meeting will be held on October 22, 2025, at 10 a.m. The project sites are located within secured areas not publicly accessible. The pre-bid meeting will be the only opportunity for prospective bidders to visit the reservoir sites during the bid phase. Attendees will assemble at the Elm Tank located adjacent to the following address: 3151 Donna Drive Carlsbad CA, 92008 Opportunity to visit the Skyline Tank at 4275 Skyline Road will be provided thereafter. Attendees will be required to sign-in on the meeting attendance log upon arriving at the water reservoir property. A signature from at least one staff member representing the bidder’s company is required to provide proof of attendance. Bids will not be accepted from any bidder who does not have a company representative in attendance at the mandatory pre-bid meeting. UNIT PRICES AND COMPUTATION OF BIDS All bids are to be computed on the basis of the given estimated quantities of work, as indicated in this proposal, times the unit price as submitted by the bidder. ADDENDA Bidders are advised to verify the issuance of all addenda and receipt thereof one day prior to bidding. Submission of bids without acknowledgment of addenda may be cause of rejection of bid. BOND AND INSURANCE REQUIREMENTS The Contractor shall provide bonds to secure faithful performance and warranty of the work in an amount equal to one hundred percent (100%) of the Contract price on this project. The Contractor shall provide bonds to secure payment of laborers and materials suppliers, in an amount equal to one hundred percent (100%) of the total amount payable by the terms of the Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 Revised 6/12/18 Contract No. 5024-3A Page 11 of 117 October 1, 2025 contract. These bonds shall be kept in full force and effect during the course of this project and shall extend in full force and effect and be retained by CMWD until they are released as stated in the General Provisions section of this contract. All bonds are to be placed with a surety insurance carrier admitted and authorized to transact the business of insurance in California and whose assets exceed their liabilities in an amount equal to or in excess of the amount of the bond. The bonds are to be accompanied by the following documents: 1. An original, or a certified copy, of the unrevoked appointment, power of attorney, by laws, or other instrument entitling or authorizing the person who executed the bond to do so. 2. A certified copy of the certificate of authority of the insurer issued by the insurance commissioner. If the bid is accepted, CMWD may require copies of the insurer's most recent annual statement and quarterly statement filed with the Department of Insurance pursuant to Article 10 (commencing with section 900) of Chapter 1 of Part 2 of Division 1 of the Insurance Code, within 10 calendar days of the insurer's receipt of a request to submit the statements. Insurance is to be placed with insurers that: 1. Have a rating in the most recent Best's Key Rating Guide of at least A-:VII 2. Are admitted and authorized to transact the business of insurance in the State of California by the Insurance Commissioner. Auto policies offered to meet the specification of this contract must: 1. Meet the conditions stated above for all insurance companies. 2. Cover any vehicle used in the performance of the contract, used onsite or offsite, whether owned, non-owned or hired, and whether scheduled or non-scheduled. Workers' compensation insurance required under this contract must be offered by a company meeting the above standards with the exception that the Best's rating condition is waived. CMWD does accept policies issued by the State Compensation Fund meeting the requirement for workers' compensation insurance. The Contractor shall be required to maintain insurance as specified in the Contract. Any additional cost of said insurance shall be included in the bid price. The award of the contract by CMWD is contingent upon the Contractor submitting the required bonds and insurance, as described in the contract, within twenty days of bid opening. If the Contractor fails to comply with these requirements, CMWD may award the contract to the second or third lowest bidder and the bid security of the lowest bidder may be forfeited. BUSINESS LICENSE The prime contractor and all subcontractors are required to have and maintain a valid City of Carlsbad Business License for the duration of the contract. Approved by the by the Board of Directors of the Carlsbad Municipal Water District, California, by Resolution No. 1784, adopted on the 30th day of September 2025. Date Graham Jordan, Deputy Clerk Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 5HYLVHG&RQWUDFW1R$3DJHRI %,'6(&85,7<)250 &KHFNWR$FFRPSDQ\%LG :$7(55(6(592,5,03529(0(17352*$0 (/0$1'6.</,1(67((/5(6(592,5&2$7,1*352-(&7 352-(&712$ 127( 7KHIROORZLQJIRUPVKDOOEHXVHGLIFKHFNDFFRPSDQLHVELG $FFRPSDQ\LQJWKLVSURSRVDOLVD &HUWLILHG &DVKLHU¶VFKHFNSD\DEOHWRWKHRUGHURI&$5/6%$' 081,&,3$/:$7(5',675,&7LQWKHVXPRIBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB GROODUV BBBBBBBBBBBBBBBB WKLVDPRXQWEHLQJWHQSHUFHQW RIWKHWRWDODPRXQWRIWKH ELG7KHSURFHHGVRIWKLVFKHFNVKDOOEHFRPHWKHSURSHUW\RIWKH'LVWULFWSURYLGHGWKLVSURSRVDO VKDOOEHDFFHSWHGE\WKH'LVWULFWWKURXJKDFWLRQRILWVOHJDOO\FRQVWLWXWHGFRQWUDFWLQJDXWKRULWLHV DQG WKH XQGHUVLJQHG VKDOO IDLO WR H[HFXWH D FRQWUDFW DQG IXUQLVK WKH UHTXLUHG 3HUIRUPDQFH :DUUDQW\ DQG 3D\PHQW %RQGV DQG SURRI RI LQVXUDQFH FRYHUDJH ZLWKLQ WKH VWLSXODWHG WLPH RWKHUZLVHWKHFKHFNVKDOOEHUHWXUQHGWRWKHXQGHUVLJQHG7KHSURFHHGVRIWKLVFKHFNVKDOODOVR EHFRPHWKHSURSHUW\RIWKH'LVWULFWLIWKHXQGHUVLJQHGVKDOOZLWKGUDZKLVRUKHUELGZLWKLQWKH SHULRGRIILIWHHQ GD\VDIWHUWKHGDWHVHWIRUWKHRSHQLQJWKHUHRIXQOHVVRWKHUZLVHUHTXLUHG E\ODZDQGQRWZLWKVWDQGLQJWKHDZDUGRIWKHFRQWUDFWWRDQRWKHUELGGHU BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB %,''(5 BBBBBBBBBBBBBBBBB 'HOHWHWKHLQDSSOLFDEOHZRUG 127( ,IWKH%LGGHUGHVLUHVWRXVHDERQGLQVWHDGRIFKHFNWKH%LG%RQGIRUPRQWKHIROORZLQJSDJHV VKDOOEHH[HFXWHGWKHVXPRIWKLVERQGVKDOOEHQRWOHVVWKDQWHQSHUFHQW RIWKHWRWDODPRXQWRIWKH ELG Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 5HYLVHG&RQWUDFW1R$3DJHRI *8,'()25&203/(7,1* 7+(³'(6,*1$7,212)68%&2175$&7256´)250 5()(5(1&(63ULRUWRSUHSDUDWLRQRIWKHIROORZLQJ³6XEFRQWUDFWRU'LVFORVXUH)RUP´%LGGHUV DUHXUJHGWRUHYLHZWKHGHILQLWLRQVLQVHFWLRQRIWKH*HQHUDO3URYLVLRQVWRWKLV&RQWUDFW HVSHFLDOO\ ³%LG´ ³%LGGHU´ ³&RQWUDFW´ ³&RQWUDFWRU´ ³&RQWUDFW 3ULFH´ ³&RQWUDFW 8QLW 3ULFH´ ³(QJLQHHU´ ³2ZQ 2UJDQL]DWLRQ´ ³6XEFRQWUDFWRU´ DQG ³:RUN´ %LGGHUV DUH IXUWKHU XUJHG WR UHYLHZVHFWLRQV68%&2175$&76RIWKH*HQHUDO3URYLVLRQV &$87,2167KLVIRUPZLOOEHXVHGE\WKH$JHQF\WRGHWHUPLQHWKHSHUFHQWDJHRIZRUNWKDWWKH %LGGHUSURSRVHVWRSHUIRUP%LGGHUVDUHFDXWLRQHGWKDWIDLOXUHWRSURYLGHFRPSOHWHDQGFRUUHFW LQIRUPDWLRQ PD\ UHVXOW LQ UHMHFWLRQ RI WKH ELG DV QRQUHVSRQVLYH $Q\ ELG WKDW SURSRVHV SHUIRUPDQFH RI PRUH WKDQ SHUFHQW RI WKH ZRUN E\ VXEFRQWUDFWRUV RU RWKHUZLVH WR EH SHUIRUPHG E\ IRUFHV RWKHU WKDQ WKH %LGGHU¶V RZQ RUJDQL]DWLRQ ZLOO EH UHMHFWHG DV QRQ UHVSRQVLYH 6SHFLDOW\ LWHPV RI ZRUN WKDW PD\ EH VR GHVLJQDWHG E\ WKH (QJLQHHU RQ WKH ³&RQWUDFWRU¶V3URSRVDO´DUHQRWLQFOXGHGLQFRPSXWLQJWKHSHUFHQWDJHRIZRUNSURSRVHGWREH SHUIRUPHGE\WKH%LGGHU ,16758&7,216 7KH%LGGHUVKDOOVHWIRUWKWKHQDPHDQGORFDWLRQRIEXVLQHVVRI HDFK DQG HYHU\VXEFRQWUDFWRUZKRPWKH%LGGHUSURSRVHVWRSHUIRUPZRUNRUODERURUUHQGHUVHUYLFHLQRU DERXWWKHZRUNRULPSURYHPHQWDQGHYHU\VXEFRQWUDFWRUOLFHQVHGDVDFRQWUDFWRUE\WKH6WDWH RI&DOLIRUQLDZKRPWKH%LGGHUSURSRVHVWRVSHFLDOO\IDEULFDWHDQGLQVWDOODQ\SRUWLRQRIWKHZRUN RU LPSURYHPHQW DFFRUGLQJ WR GHWDLOHG GUDZLQJV FRQWDLQHG LQ WKHSODQV DQG VSHFLILFDWLRQV LQ H[FHVVRIRQHKDOIRIRQHSHUFHQW RIWKH%LGGHU¶VWRWDOELGRULQWKHFDVHRIELGVRURIIHUV IRUWKHFRQVWUXFWLRQRIVWUHHWVDQGKLJKZD\VLQFOXGLQJEULGJHVLQH[FHVVRIRQHKDOIRIRQH SHUFHQW RU WHQ WKRXVDQG GROODUV ZKLFKHYHU LV JUHDWHU 6DLG QDPH V DQG ORFDWLRQ V RIEXVLQHVVRIVXEFRQWUDFWRU V VKDOOEHVHWIRUWKDQGLQFOXGHGDVDQLQWHJUDOSDUWRI WKHELGRIIHU 7KH'HVLJQDWLRQRI6XEFRQWUDFWRUVIRUPPXVWEHVXEPLWWHGDVDSDUWRIWKH%LGGHU¶VVHDOHGELG )DLOXUHWRSURYLGHFRPSOHWHDQGFRUUHFWLQIRUPDWLRQPD\UHVXOWLQUHMHFWLRQRIWKHELGDVQRQ UHVSRQVLYH 6XSSOLHUVRIPDWHULDOVIURPVRXUFHVRXWVLGHWKHOLPLWVRIZRUNDUHQRWVXEFRQWUDFWRUV7KHYDOXH RIPDWHULDOVDQGWUDQVSRUWRIPDWHULDOVIURPVRXUFHVRXWVLGHWKHOLPLWVRIZRUNDVVKRZQRQWKH SODQVVKDOOEHDVVLJQHGWRWKH&RQWUDFWRURUWKH6XEFRQWUDFWRUDVWKHFDVHPD\EHWKDWWKH %LGGHU SURSRVHV DV LQVWDOOHU RI VDLG PDWHULDOV 7KH YDOXH RI PDWHULDO LQFRUSRUDWHG LQ DQ\ 6XEFRQWUDFWRULQVWDOOHGELGLWHPWKDWLVVXSSOLHGE\WKH%LGGHUVKDOOEHLQFOXGHGDVDSDUWRIWKH ZRUNWKDWWKH%LGGHUSURSRVHVWREHSHUIRUPHGE\WKH6XEFRQWUDFWRULQVWDOOLQJVDLGLWHP :KHQD6XEFRQWUDFWRUKDVD&DUOVEDGEXVLQHVVOLFHQVHWKHQXPEHUPXVWEHHQWHUHGRQWKH SURSHUIRUP,IWKH6XEFRQWUDFWRUGRHVQRWKDYHDYDOLGEXVLQHVVOLFHQVHHQWHU³121(´LQWKH DSSURSULDWHVSDFH :KHQWKH%LGGHUSURSRVHVXVLQJD6XEFRQWUDFWRUWRFRQVWUXFWRULQVWDOOOHVVWKDQSHUFHQWRI DELGLWHPWKH%LGGHUVKDOODWWDFKDQH[SODQDWLRQVKHHWWRWKH'HVLJQDWLRQRI6XEFRQWUDFWRU IRUP7KHH[SODQDWLRQVKHHWVKDOOFOHDUO\DSSULVHWKH'LVWULFWRIWKHVSHFLILFIDFWVWKDWVKRZWKH %LGGHUSURSRVHVWRSHUIRUPQROHVVWKDQILIW\SHUFHQW RIWKHZRUNZLWKLWVRZQIRUFHV Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 5HYLVHG&RQWUDFW1R$3DJHRI 'HWHUPLQDWLRQ RI WKH VXEFRQWUDFW DPRXQWV IRU SXUSRVHV RI DZDUGRI WKH FRQWUDFW VKDOO EH GHWHUPLQHG E\ WKH %RDUG RI 'LUHFWRUV LQ FRQIRUPDQFH ZLWK WKH SURYLVLRQV RI WKH FRQWUDFW GRFXPHQWVDQGWKHYDULRXVVXSSOHPHQWDOSURYLVLRQV7KHGHFLVLRQ RI WKH%RDUG RI 'LUHFWRUV VKDOOEHILQDO &RQWUDFWRULVSURKLELWHGIURPSHUIRUPLQJDQ\ZRUNRQWKLVSURMHFWZLWKDVXEFRQWUDFWRUZKRLV LQHOLJLEOHWRSHUIRUPZRUNRQDSXEOLFZRUNVSURMHFWSXUVXDQWWR/DERU&RGH6HFWLRQVRU %LGGHUV VKDOO PDNH DQ\ DGGLWLRQDO FRSLHV RI WKH GLVFORVXUH IRUPV DV PD\ EH QHFHVVDU\ WR SURYLGHWKHUHTXLUHGLQIRUPDWLRQ7KHSDJHQXPEHUDQGWRWDOQXPEHURIDGGLWLRQDOIRUPSDJHV VKDOOEHHQWHUHGLQWKHORFDWLRQSURYLGHGRQHDFKW\SHRIIRUPVRGXSOLFDWHG Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 ANY PROPRIETOR/PARTNER/EXECUTIVEOFFICER/MEMBER EXCLUDED? INSR ADDL SUBRLTRINSD WVD PRODUCER CONTACTNAME:FAXPHONE(A/C, No):(A/C, No, Ext): E-MAILADDRESS: INSURER A : INSURED INSURER B : INSURER C : INSURER D : INSURER E : INSURER F : POLICY NUMBER POLICY EFF POLICY EXPTYPE OF INSURANCE LIMITS(MM/DD/YYYY) (MM/DD/YYYY) AUTOMOBILE LIABILITY UMBRELLA LIAB EXCESS LIAB WORKERS COMPENSATIONAND EMPLOYERS' LIABILITY DESCRIPTION OF OPERATIONS / LOCATIONS / VEHICLES (ACORD 101, Additional Remarks Schedule, may be attached if more space is required) AUTHORIZED REPRESENTATIVE EACH OCCURRENCE $DAMAGE TO RENTEDCLAIMS-MADE OCCUR $PREMISES (Ea occurrence) MED EXP (Any one person)$ PERSONAL & ADV INJURY $ GEN'L AGGREGATE LIMIT APPLIES PER:GENERAL AGGREGATE $ PRO-POLICY LOC PRODUCTS - COMP/OP AGGJECT OTHER:$COMBINED SINGLE LIMIT $(Ea accident) ANY AUTO BODILY INJURY (Per person)$OWNED SCHEDULED BODILY INJURY (Per accident)$AUTOS ONLY AUTOS HIRED NON-OWNED PROPERTY DAMAGE $AUTOS ONLY AUTOS ONLY (Per accident) $ OCCUR EACH OCCURRENCE CLAIMS-MADE AGGREGATE $ DED RETENTION $ PER OTH-STATUTE ER E.L. EACH ACCIDENT E.L. DISEASE - EA EMPLOYEE $If yes, describe under E.L. DISEASE - POLICY LIMITDESCRIPTION OF OPERATIONS below INSURER(S) AFFORDING COVERAGE NAIC # COMMERCIAL GENERAL LIABILITY Y / N N / A(Mandatory in NH) SHOULD ANY OF THE ABOVE DESCRIBED POLICIES BE CANCELLED BEFORE THE EXPIRATION DATE THEREOF, NOTICE WILL BE DELIVERED INACCORDANCE WITH THE POLICY PROVISIONS. THIS IS TO CERTIFY THAT THE POLICIES OF INSURANCE LISTED BELOW HAVE BEEN ISSUED TO THE INSURED NAMED ABOVE FOR THE POLICY PERIOD INDICATED. NOTWITHSTANDING ANY REQUIREMENT, TERM OR CONDITION OF ANY CONTRACT OR OTHER DOCUMENT WITH RESPECT TO WHICH THIS CERTIFICATE MAY BE ISSUED OR MAY PERTAIN, THE INSURANCE AFFORDED BY THE POLICIES DESCRIBED HEREIN IS SUBJECT TO ALL THE TERMS,EXCLUSIONS AND CONDITIONS OF SUCH POLICIES. LIMITS SHOWN MAY HAVE BEEN REDUCED BY PAID CLAIMS. THIS CERTIFICATE IS ISSUED AS A MATTER OF INFORMATION ONLY AND CONFERS NO RIGHTS UPON THE CERTIFICATE HOLDER. THISCERTIFICATE DOES NOT AFFIRMATIVELY OR NEGATIVELY AMEND, EXTEND OR ALTER THE COVERAGE AFFORDED BY THE POLICIESBELOW. THIS CERTIFICATE OF INSURANCE DOES NOT CONSTITUTE A CONTRACT BETWEEN THE ISSUING INSURER(S), AUTHORIZEDREPRESENTATIVE OR PRODUCER, AND THE CERTIFICATE HOLDER. IMPORTANT: If the certificate holder is an ADDITIONAL INSURED, the policy(ies) must have ADDITIONAL INSURED provisions or be endorsed. If SUBROGATION IS WAIVED, subject to the terms and conditions of the policy, certain policies may require an endorsement. A statement onthis certificate does not confer rights to the certificate holder in lieu of such endorsement(s). COVERAGES CERTIFICATE NUMBER:REVISION NUMBER: CERTIFICATE HOLDER CANCELLATION © 1988-2015 ACORD CORPORATION. All rights reserved.ACORD 25 (2016/03) CERTIFICATE OF LIABILITY INSURANCE DATE (MM/DD/YYYY) $ $ $ $ $ The ACORD name and logo are registered marks of ACORD 12/18/2025 License # 0M63276 (909) 593-7776 (909) 593-5477 17370 Simpson Sandblasting & Special Coatings, Inc.14665 Rancho Vista Dr. Fontana, CA 92335 10885 35076 A 1,000,000 X X ECP2046946-10 5/1/2025 5/1/2026 100,000 5,000 1,000,000 2,000,000 2,000,000 POLLUTION LIAB 1,000,000 1,000,000B BAP2046960-10 5/1/2025 5/1/2026 5,000,000A FFX2046947-10 5/1/2025 5/1/2026 5,000,000 C X 9297397-25 5/1/2025 5/1/2026 1,000,000 1,000,000 1,000,000 Re: All operations performed by the named insured. Certificate holder is included as Additional Insured with Primary/Non-Contributory per attached ECP1246 (01/21) and ECP1248 (01/21).G/L & W/C waiver of subrogation applies per ECP1260 (01/21) & State Fund endorsement attached. City of Carlsbad/CMWD c/o EXIGIS Insurance Compliance Services P.O. Box 947 Murrieta, CA 92564 SIMPSAN-01 IJACKSON Hardy Insurance - Alkeme Insurance Services2911 Bonita Avenue Suite ALa Verne, CA 91750 Christine Crilley, CISR ccrilley@alkemeins.com Nautilus Insurance Company Key Risk Insurance Company State Compensation Insurance Fund of California X X X X X X X X X Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 E!P 1246 01 21 Includes copyrighted material of Insurance Services Office, Inc., used with its permission.Page 1 of ! THIS ENDORSEMENT CHANGES THE POLICY. PLEASE READ IT CAREFULLY. ADDITIONAL INSURED -- OWNERS, LESSEES OR CONTRACTORS AUTOMATIC STATUS ONGOING OPERATIONS COVERAGE A, B, D.1 & D.4 Policy Number Policy Effective Date Policy Expiration Date Endorsement Effective Date E!P2046946-10 5/1/2025 5/1/2026 5/1/2025 This endorsement modifies insurance provided under the following: ENVIRONMENTAL COMBINED POLICY I. SECTION III WHO IS AN INSURED is amended to include as an additional insured: 1.Any person or organization for whom you are performing operations when you and such person or organization have agreed in writing in a contract or agreement, in effect during this policy period, that such person or organization be added as an additional insured on this policy; and !.Any other person or organization you are explicitly required to add as an additional insured under the contract or agreement described in Paragraph 1. above. Such contract or agreement must be executed and in effect prior to the performance of your work which is the subject of such contract or agreement. Such person(s) or organization(s) is an additional insured only with respect to liability for bodily injury or property damage under SECTION I COVERAGE A BODILY INJURY AND PROPERTY DAMAGE LIABILITY, Coverage D.1 Contractors Pollution Legal Liability and Coverage D.4 Microbial Substance Contractors Pollution Liability, or personal injury or advertising injury under SECTION I - COVERAGE B PERSONAL AND ADVERTISING INJURY LIABILITY directly caused by: a.Your acts or omissions; or b.The acts or omissions of those acting on your behalf; in the performance of your ongoing operations for the additional insured described in Paragraph 1. or !. above. However, the insurance afforded to such additional insured described above: a.Only applies to the extent permitted by law; and b.Will not be broader than that which you are required by the contract or agreement to provide for such additional insured, and c.Will not extend beyond that which is provided to you in this policy. A person5s or organization5s status as an additional insured under this endorsement ends when your operations for the person or organization described in Paragraph 1. above are completed. II.With respect to the insurance afforded to these additional insureds, the following additional exclusions apply: This insurance does not apply to: a. Bodily injury, property damage or personal and advertising injury arising out of the rendering of, or the failure to render, any professional architectural, engineering or surveying services, including: (1)The preparing, approving, or failing to prepare or approve, maps, shop drawings, opinions, reports, surveys, field orders, change orders or drawings and specifications; or (!)Supervisory, inspection, architectural or engineering activities. This exclusion applies even if the claims against any insured allege negligence or other wrongdoing in the supervision, hiring, employment, training or monitoring of others by that insured, if the occurrence which caused the bodily injury or property damage, or the offense which caused the personal and advertising injury, involved the rendering of, or the failure to render any professional architectural, engineering or surveying services. b. Bodily injury or property damage occurring after: (1)All work, including materials, parts or equipment furnished in connection with such work, on the project (other than service, maintenance or repairs) to be performed by or on behalf of the additional insured(s) at the location of the covered operations has been completed; or Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 E!P 1246 01 21 Includes copyrighted material of Insurance Services Office, Inc., used with its permission.Page ! of ! (!)That portion of your work out of which the injury or damage arises has been put to its intended use by any person or organization other than another contractor or subcontractor engaged in performing operations for a principal as a part of the same project. III.With respect to the insurance afforded to these additional insureds, the following is added to SECTION V LIMITS OF INSURANCE: The most we will pay on behalf of the additional insured is the amount of insurance: 1.Required by the contract or agreement described in Paragraph I.1.; or !.Available under the applicable limits of insurance; whichever is less. This endorsement shall not increase the applicable limits of insurance. IV.With respect to the insurance afforded to these additional insureds, the following is added to SECTION VI REPORTING, DEFENSE, SETTLEMENT & COOPERATION: 1. Duties -- Additional Insured An additional insured must see to it that: a.We are notified in writing as soon as practicable of an occurrence or offense which may result in a claim or suit; b.We receive written notice of a claim or suit as soon as practicable; and c.A request for defense and indemnity of the claim or suit will promptly be brought against any policy issued by another insurer under which the additional insured may be an insured in any capacity. This provision does not apply to insurance on which the additional insured is a Named Insured, if the contract or agreement requires that this coverage be primary and noncontributory. V. SECTION VII CONDITION 10. Other Insurance is amended by the addition of the following which supersedes any provision to the contrary: Primary And Noncontributory Insurance This insurance is primary to and will not seek contribution from any other insurance available to a person(s) or organization(s) included as an additional insured under this endorsement provided that: 1.The additional insured person(s) or organization(s) is a Named Insured under such other insurance; and !.You have agreed in writing in a contract or agreement, in effect during this policy period, that this insurance would be primary and would not seek contribution from any other insurance available to the additional insured person(s) or organization(s). Such contract or agreement must be executed and in effect prior to the performance of your work which is the subject of such contract or agreement. However, this provision does not apply if the other insurance available to the person(s) or organization(s) included as an additional insured is Owners and !ontractors Protective Liability, Railroad Protective Liability, or similar project- specific, primary insurance. VI.This endorsement does not apply to an additional insured which has been added to this policy by an endorsement showing the additional insured in a SCHEDULE of additional insureds, and which endorsement applies to that designated additional insured. ALL OTHER TERMS AND CONDITIONS OF THE POLICY SHALL APPLY AND REMAIN UNCHANGED. Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 E!P 1248 01 21 Includes copyrighted material of Insurance Services Office, Inc., used with its permission.Page 1 of ! THIS ENDORSEMENT CHANGES THE POLICY. PLEASE READ IT CAREFULLY. ADDITIONAL INSURED -- OWNERS, LESSEES OR CONTRACTORS AUTOMATIC STATUS COMPLETED OPERATIONS COVERAGE A, D.1 & D.4 Policy Number Policy Effective Date Policy Expiration Date Endorsement Effective Date E!P2046946-10 5/1/2025 5/1/2026 5/1/2025 This endorsement modifies insurance provided under the following: ENVIRONMENTAL COMBINED POLICY I. SECTION III WHO IS AN INSURED is amended to include as an additional insured: 1.Any person or organization for whom you have performed operations when you and such person or organization have agreed in writing in a contract or agreement, in effect during this policy period, that such person or organization be added as an additional insured on this policy; and !.Any other person or organization you are explicitly required to add as an additional insured under the contract or agreement described in Paragraph 1. above. Such contract or agreement must be executed and in effect prior to the performance of your work included in the products-completed operations hazard which is the subject of such contract or agreement. Such person(s) or organization(s) is an additional insured only with respect to liability for bodily injury or property damage under SECTION I COVERAGE A BODILY INJURY AND PROPERTY DAMAGE LIABILITY, Coverage D.1 Contractors Pollution Legal Liability and Coverage D.4 Microbial Substance Contractors Pollution Liability, directly caused by your work performed for the additional insured described in Paragraph 1. or !. above, and included in the products-completed operations hazard. However, the insurance afforded to such additional insured described above: a.Only applies to the extent permitted by law; and b.Will not be broader than that which you are required by the contract or agreement to provide for such additional insured; and c.Will not extend beyond that which is provided to you in this policy. II.With respect to the insurance afforded to these additional insureds, the following additional exclusions apply: This insurance does not apply to: a. Bodily injury or property damage arising out of the rendering of, or the failure to render, any professional architectural, engineering or surveying services, including: (1)The preparing, approving, or failing to prepare or approve, maps, shop drawings, opinions, reports, surveys, field orders, change orders or drawings and specifications; or (!)Supervisory, inspection, architectural or engineering activities. This exclusion applies even if the claims against any insured allege negligence or other wrongdoing in the supervision, hiring, employment, training or monitoring of others by that insured, if the occurrence which caused the bodily injury or property damage involved the rendering of, or the failure to render any professional architectural, engineering or surveying services. III.With respect to the insurance afforded to these additional insureds, the following is added to SECTION V LIMITS OF INSURANCE: The most we will pay on behalf of the additional insured is the amount of insurance: 1.Required by the contract or agreement described in Paragraph I.1.; or !.Available under the applicable limits of insurance; whichever is less. This endorsement shall not increase the applicable limits of insurance. IV.With respect to the insurance afforded to these additional insureds, the following is added to SECTION VI Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 E!P 1248 01 21 Includes copyrighted material of Insurance Services Office, Inc., used with its permission.Page ! of ! REPORTING, DEFENSE, SETTLEMENT & COOPERATION: 1. Duties -- Additional Insured An additional insured must see to it that: a.We are notified in writing as soon as practicable of an occurrence which may result in a claim or suit; b.We receive written notice of a claim or suit as soon as practicable; and c.A request for defense and indemnity of the claim or suit will promptly be brought against any policy issued by another insurer under which the additional insured may be an insured in any capacity. This provision does not apply to insurance on which the additional insured is a Named Insured, if the contract or agreement requires that this coverage be primary and noncontributory. V. SECTION VII CONDITION 10. Other Insurance is amended by the addition of the following which supersedes any provision to the contrary: Primary And Noncontributory Insurance This insurance is primary to and will not seek contribution from any other insurance available to a person(s) or organization(s) included as an additional insured under this endorsement provided that: 1.The additional insured person(s) or organization(s) is a Named Insured under such other insurance; and !.You have agreed in writing in a contract or agreement, in effect during this policy period, that this insurance would be primary and would not seek contribution from any other insurance available to the additional insured person(s) or organization(s). Such contract or agreement must be executed and in effect prior to the performance of your work included in the products-completed operations hazard which is the subject of such contract or agreement. However, this provision does not apply if the other insurance available to the person(s) or organization(s) included as an additional insured is Owners and !ontractors Protective Liability, Railroad Protective Liability, or similar project- specific, primary insurance. VI.This endorsement does not apply to an additional insured which has been added to this policy by an endorsement showing the additional insured in a SCHEDULE of additional insureds, and which endorsement applies to that designated additional insured. ALL OTHER TERMS AND CONDITIONS OF THE POLICY SHALL APPLY AND REMAIN UNCHANGED. Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 E!P 1260 01 21 Includes copyrighted material of Insurance Services Office, Inc., used with its permission.Page 1 of 1 !HIS ENDORSEMEN! CHANGES !HE POLICY. PLEASE READ I! CAREFULLY. WAIVER OF SUBROGA!ION (!RANSFER OF RIGH!S OF RECOVERY AGAINS! O!HERS !O US) AU!OMA!IC S!A!US COVERAGE A, B & D Policy Number Policy Effective Date Policy Expiration Date Endorsement Effective Date E!P2046946-10 5/1/2025 5/1/2026 5/1/2025 This endorsement modifies insurance provided under the following: ENVIRONMEN!AL COMBINED POLICY I.The following is added to Paragraph 17. Subrogation of SEC!ION VII CONDI!IONS: We waive any right of recovery against any person(s) or organization(s) because of payments we make under COVERAGE A BODILY INJURY AND PROPER!Y DAMAGE LIABILI!Y, COVERAGE B PERSONAL AND ADVER!ISING INJURY LIABILI!Y, and COVERAGE D CON!RAC!ORS POLLU!ION LIABILI!Y under this policy. Such waiver by us applies only if: 1.The insured has agreed in writing in a contract or agreement with such person(s) or organization(s) to waive its right of recovery; and 2.The insured has waived its right of recovery against such person(s) or organization(s) prior to loss. This waiver does not apply in any jurisdiction where such waiver is held to be illegal or against public policy or in any situation where the person(s) or organization(s) against whom subrogation is to be waived is found to be solely negligent. This endorsement does not apply to any person(s) or organization(s) designated in a SCHEDULE of person(s) or organization(s) against whom rights of recovery have been waived. ALL O!HER !ERMS AND CONDI!IONS OF !HE POLICY SHALL APPLY AND REMAIN UNCHANGED. Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 Revised 6/12/18 Contract No. 5024-3A Page 29 of 117 CONTRACT PUBLIC WORKS This agreement is made this ____________ day of ____________________________, 2026, by and between the Carlsbad Municipal Water District of the City of Carlsbad, California, a municipal corporation, (hereinafter called "District"), and Simpson Sandblasting & Special Coatings, Inc., whose principal place of business is 14665 Rancho Vista Drive, Fontana, California 92335 (hereinafter called "Contractor"). District and Contractor agree as follows: 1. Description of Work. Contractor shall perform all work specified in the Contract documents for: WATER RESERVOIR IMPROVEMENT PROGAM ELM AND SKYLINE STEEL RESERVOIR COATING PROJECT PROJECT NO. 5024-3A (hereinafter called "project") 2. Provisions of Labor and Materials. Contractor shall provide all labor, materials, tools, equipment, and personnel to perform the work specified by the Contract Documents. 3. Contract Documents. The Contract Documents consist of this Contract, Notice Inviting Bids, Contractor's Proposal, Bidder's Bond, Noncollusion Declaration, Designation of Subcontractors, Technical Ability and Experience, Bidder’s Statement Re Debarment, Escrow Agreement, Release Form, the Plans and Specifications, the General Provisions, addendum(s) to said Plans and Specifications and General Provisions, and all proper amendments and changes made thereto in accordance with this Contract or the Plans and Specifications, and all bonds for the project; all of which are incorporated herein by this reference. Contractor, her/his subcontractors, and materials suppliers shall provide and install the work as indicated, specified, and implied by the Contract Documents. Any items of work not indicated or specified, but which are essential to the completion of the work, shall be provided at the Contractor's expense to fulfill the intent of said documents. In all instances through the life of the Contract, the District will be the interpreter of the intent of the Contract Documents, and the District’s decision relative to said intent will be final and binding. Failure of the Contractor to apprise subcontractors and materials suppliers of this condition of the Contract will not relieve responsibility of compliance. 4. Payment. For all compensation for Contractor's performance of work under this Contract, District shall make payment to the Contractor per section 9-3 PAYMENT of the General Provisions section of this contract. The Engineer will close the estimate of work completed for progress payments on the last working day of each month. The District shall withhold retention as required by Public Contract Code Section 9203. 5. Independent Investigation. Contractor has made an independent investigation of the jobsite, the soil conditions at the jobsite, and all other conditions that might affect the progress of the work and is aware of those conditions. The Contract price includes payment for all work that may be done by Contractor, whether anticipated or not, in order to overcome underground Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 18th March Revised 6/12/18 Contract No. 5024-3A Page 30 of 117 conditions. Any information that may have been furnished to Contractor by District about underground conditions or other job conditions is for Contractor's convenience only, and District does not warrant that the conditions are as thus indicated. Contractor is satisfied with all job conditions, including underground conditions and has not relied on information furnished by District. 6. Hazardous Waste or Other Unusual Conditions. If the contract involves digging trenches or other excavations that extend deeper than four feet below the surface Contractor shall promptly, and before the following conditions are disturbed, notify District, in writing, of any: A. Hazardous Waste. Material that Contractor believes may be material that is hazardous waste, as defined in section 25117 of the Health and Safety Code, that is required to be removed to a Class I, Class II, or Class III disposal site in accordance with provisions of existing law. B. Differing Conditions. Subsurface or latent physical conditions at the site differing from those indicated. C. Unknown Physical Conditions. Unknown physical conditions at the site of any unusual nature, different materially from those ordinarily encountered and generally recognized as inherent in work of the character provided for in the contract. District shall promptly investigate the conditions, and if it finds that the conditions do materially so differ, or do involve hazardous waste, and cause a decrease or increase in contractor's costs of, or the time required for, performance of any part of the work shall issue a change order under the procedures described in this contract. In the event that a dispute arises between District and Contractor whether the conditions materially differ, or involve hazardous waste, or cause a decrease or increase in the contractor's cost of, or time required for, performance of any part of the work, contractor shall not be excused from any scheduled completion date provided for by the contract, but shall proceed with all work to be performed under the contract. Contractor shall retain any and all rights provided either by contract or by law which pertain to the resolution of disputes and protests between the contracting parties. 7. Immigration Reform and Control Act. Contractor certifies it is aware of the requirements of the Immigration Reform and Control Act of 1986 (8 USC sections 1101-1525) and has complied and will comply with these requirements, including, but not limited to, verifying the eligibility for employment of all agents, employees, subcontractors, and consultants that are included in this Contract. 8. Prevailing Wage. Pursuant to the California Labor Code, the director of the Department of Industrial Relations has determined the general prevailing rate of per diem wages in accordance with California Labor Code, section 1773 and a copy of a schedule of said general prevailing wage rates is on file in the office of the City Engineer and is incorporated by reference herein. Pursuant to California Labor Code, section 1775, Contractor shall pay prevailing wages. Contractor shall post copies of all applicable prevailing wages on the job site. Contractor shall comply with California Labor Code, section 1776, which generally requires keeping accurate payroll records, verifying and certifying payroll records, and making them available for inspection. Contractor shall require all subcontractors to comply with Section 1776. Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 Revised 6/12/18 Contract No. 5024-3A Page 31 of 117 9. Indemnification. Contractor shall assume the defense of, pay all expenses of defense, and indemnify and hold harmless the District, and its officers and employees, from all claims, loss, damage, injury and liability of every kind, nature and description, directly or indirectly arising from or in connection with the performance of the Contract or work; or from any failure or alleged failure of Contractor to comply with any applicable law, rules or regulations including those relating to safety and health; and from any and all claims, loss, damages, injury and liability, howsoever the same may be caused, resulting directly or indirectly from the nature of the work covered by the Contract, except for loss or damage caused by the sole or active negligence or willful misconduct of the District. The expenses of defense include all costs and expenses including attorneys' fees for litigation, arbitration, or other dispute resolution method. Contractor shall also defend and indemnify the District against any challenges to the award of the contract to Contractor, and Contractor will pay all costs, including defense costs for the District. Defense costs include the cost of separate counsel for District, if District requests separate counsel. Contractor shall also defend and indemnify the District against any challenges to the award of the contract to Contractor, arising in whole or in part from alleged inaccuracies or misrepresentation by the Contractor, whether intentional or otherwise, and Contractor will pay all costs, including defense costs for the District. Defense costs include the cost of separate counsel for District, if District requests separate counsel. 10. Insurance. Contractor shall procure and maintain for the duration of the contract insurance against claims for injuries to persons or damage to property which may arise from or in connection with the performance of the work hereunder by the Contractor, his or her agents, representatives, employees or subcontractors. Said insurance shall meet the City of Carlsbad’s policy for insurance as stated in City Council Policy # 70. (A) Coverages and Limits Contractor shall maintain the types of coverages and minimum limits indicted herein: a. Commercial General Liability (GLC) Insurance: Insurance written on an “occurrence” basis, including products-completed operations, personal & advertising injury, with limits no less than $2,000,000 per occurrence. If a general aggregate limit applies, either the general aggregate limit shall apply separately to this project/location or the general aggregate limit shall be twice the required occurrence limit. b. Business Automobile Liability Insurance: $2,000,000 combined single limit per accident for bodily injury and property damage. In addition, the auto policy must cover any vehicle used in the performance of the contract, used onsite or offsite, whether owned, non- owned or hired, and whether scheduled or non-scheduled. c. Workers' Compensation and Employers' Liability Insurance: Workers' compensation limits as required by the Labor Code of the State of California and Employers’ Liability limits of $1,000,000 per incident. Workers' compensation offered by the State Compensation Insurance Fund is acceptable to the District. (B) Additional Provisions: Contractor shall ensure that the policies of insurance required under this agreement with the exception of Workers’ Compensation and Business Automobile Liability Insurance contain, or are endorsed to contain, the following provisions. Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 Revised 6/12/18 Contract No. 5024-3A Page 32 of 117 a. The District, its officials, employees and volunteers are to be covered as additional insured as respects: liability arising out of activities performed by or on behalf of the Contractor; products and completed operations of the contractor; premises owned, leased, hired or borrowed by the contractor. The coverage shall contain no special limitations on the scope of protection afforded to the District, its officials, employees or volunteers. All additional insured endorsements must be evidenced using separate documents attached to the certificate of insurance; one for each company affording general liability, and employers’ liability coverage. b. The Contractor's insurance coverage shall be primary insurance as respects the District, its officials, employees and volunteers. Any insurance or self-insurance maintained by the District, its officials, employees or volunteers shall be in excess of the contractor's insurance and shall not contribute with it. c. Any failure to comply with reporting provisions of the policies shall not affect coverage provided to the District, its officials, employees or volunteers. d. Coverage shall state that the contractor's insurance shall apply separately to each insured against whom claim is made or suit is brought, except with respect to the limits of the insurer's liability. (C) Notice of Cancellation. Each insurance policy required by this agreement shall be endorsed to state that coverage shall not be nonrenewed, suspended, voided, canceled, or reduced in coverage or limits except after ten (10) days' prior written notice has been sent to the District by certified mail, return receipt requested. (D) Deductibles and Self-Insured Retention (S.I.R.) Levels. Any deductibles or self- insured retention levels must be declared to and approved by the District. At the option of the District, either: the insurer shall reduce or eliminate such deductibles or self-insured retention levels as respects the District, its officials and employees; or the contractor shall procure a bond guaranteeing payment of losses and related investigation, claim administration and defense expenses. (E) Waiver of Subrogation. All policies of insurance required under this agreement shall contain a waiver of all rights of subrogation the insurer may have or may acquire against the District or any of its officials or employees. (F) Subcontractors. Contractor shall include all subcontractors as insured under its policies or shall furnish separate certificates and endorsements for each subcontractor. Coverages for subcontractors shall be subject to all of the requirements stated herein. (G) Acceptability of Insurers. Insurance is to be placed with insurers that have a rating in Best's Key Rating Guide of at least A-:VII. Insurers must also be authorized to transact the business of insurance by the State of California Insurance Commissioner as admitted carriers as evidenced by a listing in the official publication of the Department of Insurance of the State of California and/or under the standards specified by City Council Policy # 70. (H) Verification of Coverage. Contractor shall furnish the District with certificates of insurance and original endorsements affecting coverage required by this clause. The certificates and endorsements for each insurance policy are to be signed by a person authorized by that insurer to bind coverage on its behalf. The certificates and endorsements are to be in forms Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 Revised 6/12/18 Contract No. 5024-3A Page 33 of 117 approved by the District and are to be received and approved by the District before the Contract is executed by the District. (I) Cost of Insurance. The Cost of all insurance required under this agreement shall be included in the Contractor's bid. 11. Claims and Lawsuits. All claims by Contractor shall be resolved in accordance with Public Contract Code section 9204, which is incorporated by reference. A copy of Section 9204 is included in Section 3 of the General Provisions. In addition, all claims by Contractor for $375,000 or less shall be resolved in accordance with the provisions in the Public Contract Code, Division 2, Part 3, Chapter 1, Article 1.5 (commencing with section 20104) which are incorporated by reference. A copy of Article 1.5 is included in Section 3 of the General Provisions. In the event of a conflict between Section 9204 and Article 1.5, Section 9204 shall apply. Notwithstanding the provisions of this section of the contract, all claims shall comply with the Government Tort Claim Act (section 900 et seq., of the California Government Code) for any claim or cause of action for money or damages prior to filing any lawsuit for breach of this agreement. (A) Assertion of Claims. Contractor hereby agrees that any contract claim submitted to the District must be asserted as part of the contract process as set forth in this agreement and not in anticipation of litigation or in conjunction with litigation. (B) False Claims. Contractor acknowledges that if a false claim is submitted to the District, it may be considered fraud and the Contractor may be subject to criminal prosecution. (C) Government Code. Contractor acknowledges that California Government Code sections 12650 et seq., the False Claims Act, provides for civil penalties where a person knowingly submits a false claim to a public entity. These provisions include false claims made with deliberate ignorance of the false information or in reckless disregard of the truth or falsity of the information. (D) Penalty Recovery. If the Carlsbad Municipal Water District seeks to recover penalties pursuant to the False Claims Act, it is entitled to recover its litigation costs, including attorney's fees. (E) Debarment for False Claims. Contractor hereby acknowledges that the filing of a false claim may subject the Contractor to an administrative debarment proceeding wherein the Contractor may be prevented from further bidding on public contracts for a period of up to five years. (F) Carlsbad Municipal Code. The provisions of Carlsbad Municipal Code sections 3.32.025, 3.32.026, 3.32.027 and 3.32.028 pertaining to false claims are incorporated herein by reference. (G) Debarment from Other Jurisdictions. Contractor hereby acknowledges that debarment by another jurisdiction is grounds for the Board of Directors of the Carlsbad Municipal Water District of the City of Carlsbad to disqualify the Contractor or subcontractor from participating in future contract bidding. Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 Revised 6/12/18 Contract No. 5024-3A Page 40 of 117 OPTIONAL ESCROW AGREEMENT FOR SECURITY DEPOSITS IN LIEU OF RETENTION This Escrow Agreement is made and entered into by and between the Carlsbad Municipal Water District whose address is 5950 El Camino Real, Carlsbad, California, 92008, hereinafter called "District" and Simpson Sandblasting & Special Coatings, Inc., whose address is 14665 Rancho Vista Drive, Fontana, California 92335, hereinafter called "Contractor" and _____________________________________________________________, whose address is ________________________________________________, hereinafter called "Escrow Agent". For the consideration hereinafter set forth, the District, Contractor and Escrow Agent agree as follows: 1. Pursuant to section 22300 of the Public Contract Code of the State of California, the Contractor has the option to deposit securities with the Escrow Agent as a substitute for retention earnings required to be withheld by the District pursuant to the Construction Contract entered into between the City and Contractor for WATER RESERVOIR IMPROVEMENT PROGAM ELM AND SKYLINE STEEL RESERVOIR COATING PROJECT PROJECT NO. 5024-3A in the amount of $2,569,819, dated ______________ (hereinafter referred to as the "Contract"). Alternatively, on written request of the Contractor, the District shall make payments of the retention earnings directly to the Escrow Agent. When the Contractor deposits the securities as a substitute for Contract earnings, the Escrow Agent shall notify the District within 10 days of the deposit. The market value of the securities at the time of the substitution shall be a least equal to the cash amount then required to be withheld as retention under the terms of the contract between the District and Contractor. Securities shall be held in the name of the District and shall designate the Contractor as the beneficial owner. 2. The District shall make progress payments to the Contractor for such funds which otherwise would be withheld from progress payments pursuant to the Contract provisions, provided that the Escrow Agent holds securities in the form and amount specified above. 3. When the District makes payment of retentions earned directly to the Escrow Agent, the Escrow Agent shall hold them for the benefit of the Contractor until such time as the escrow created under this contract is terminated. The Contractor may direct the investment of the payments into securities. All terms and conditions of this agreement and the rights and responsibilities of the parties shall be equally applicable and binding when the District pays the Escrow Agent directly. 4. The Contractor shall be responsible for paying all fees for the expenses incurred by the Escrow Agent in administering the Escrow Account and all expenses of the District. These expenses and payment terms shall be determined by the District, Contractor and Escrow Agent. 5. The interest earned on the securities or the money market accounts held in escrow and all interest earned on that interest shall be for the sole account of Contractor and shall be subject to withdrawal by Contractor at any time and from time to time without notice to the District. Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 Revised 6/12/18 Contract No. 5024-3A Page 41 of 117 6. Contractor shall have the right to withdraw all or any part of the principal in the Escrow Account only by written notice to Escrow Agent accompanied by written authorization from District to the Escrow Agent that District consents to the withdrawal of the amount sought to be withdrawn by Contractor. 7. The District shall have a right to draw upon the securities in the event of default by the Contractor. Upon seven days' written notice to the Escrow Agent from the District of the default, the Escrow Agent shall immediately convert the securities to cash and shall distribute the cash as instructed by the District. 8. Upon receipt of written notification from the City certifying that the Contract is final and complete and that the Contractor has complied with all requirements and procedures applicable to the Contract, the Escrow Agent shall release to Contractor all securities and interest on deposit less escrow fees and charges of the Escrow Account. The escrow shall be closed immediately upon disbursement of all moneys and securities on deposit and payments of fees and charges. 9. The Escrow Agent shall rely on the written notifications from the District and the Contractor pursuant to sections (1) to (8), inclusive, of this agreement and the District and Contractor shall hold Escrow Agent harmless from Escrow Agent's release, conversion and disbursement of the securities and interest as set forth above. 10. The names of the persons who are authorized to give written notices or to receive written notice on behalf of the District and on behalf of Contractor in connection with the foregoing, and exemplars of their respective signatures are as follows: For District: Title FINANCE DIRECTOR Name Signature Address 1635 Faraday Avenue, Carlsbad, CA 92008 For Contractor: Title Name Signature Address For Escrow Agent: Title Name Signature Address Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 Revised 6/12/18 Contract No. 5024-3A Page 42 of 117 At the time the Escrow Account is opened, the City and Contractor shall deliver to the Escrow Agent a fully executed counterpart of this Agreement. IN WITNESS WHEREOF, the parties have executed this Agreement by their proper officers on the date first set forth above. For District: Title PRESIDENT Name Signature Address 1200 Carlsbad Village Drive, Carlsbad, CA 92008 For Contractor: Title Name Signature Address For Escrow Agent: Title Name Signature Address Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 Contract No. 5024-3A – PWS26-3918UTIL 1 Addendum No. 1 CARLSBAD MUNICIPAL WATER DISTRICT ELM AND SKYLINE STEEL RESERVOIR COATING PROJECT Contract No. 5024-3A Bid No. PWS26-3918UTIL Addendum No. 1 From: Graham Jordan, Contract Administrator Phone: 760-602-2462 graham.jordan@carlsbadca.gov No. of Pages: 39 pages Date: October 27, 2025 Bid Opening Date: November 19, 2025 - 11 a.m. (revised) NOTICE: This Addendum forms a part of the Contract Documents for the above identified project and modifies portions of the original Contract Specifications and/or Plans. Documents not specifically mentioned in this Addendum remain in full force. Acknowledge receipt of this Addendum on the Bid Form. Failure to do so may subject bidder to disqualification. Please note change in bid opening date for the above-mentioned bid. New date and time for bid opening is: Wednesday, November 19, 2025, 11 a.m. MODIFICATIONS, DELETIONS, AND ADDITIONS TO THE NOTICE INVITING BIDS ITEM NO. 1: DUE DATE Change the due date wherever it is referenced in the Request for Bids to November 19, 2025, at 11 a.m. Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 Contract No. 5024-3A – PWS26-3918UTIL 2 Addendum No. 1 MODIFICATIONS, DELETIONS, AND/OR ADDITIONS TO THE GENERAL PROVISIONS ITEM NO. 1: 9-4 BID ITEM DESCRIPTIONS The following bid item descriptions are revised as follows: Replace roof vent screens The contract lump sum paid for this bid item shall constitute full compensation to remove existing roof vent screens and for furnishing and installing new vent screens in-kind. Screening shall consist of a #20 #24 mesh stainless steel interior screen and #2 #4 mesh stainless steel exterior screen. All clamps and interior frames shall be replaced in-kind. Screen size, type and quantity for each tank are detailed in Appendix A. Furnish and install interior coating system The contract lump sum paid for this bid item shall constitute full compensation to provide all labor, material, tools and equipment for the installation of an inside coating system (ICS) to all interior surfaces previously blast cleaned. All work shall be completed in accordance with Technical Specification 099713. The price paid shall include, but not be limited to preparation of containment and ventilation plans by a California certified industrial hygienist; preparation of a health and safety plan; applicable local or State air pollution control permits and payment of fees; air quality monitoring and testing for compliance with permits; design, fabrication and installation of a containment system for abrasive blasting and coating operations; design and implementation of a dehumidification and ventilation plan; field surface preparation of welded steel tank and appurtenances; application, curing, and coordination with District for testing and inspection of interior and exterior tank coating systems; tank cleaning; disinfection in accordance Method 2 of AWWA D102-24; bacteria and VOC testing; warranty diving inspection; and all incidental work or services required to coat the tank interior and return the facility back to service. MODIFICATIONS, DELETIONS, AND/OR ADDITIONS TO THE TECHNICAL SPECIFICATIONS ITEM NO. 1: TECHNICAL SPECIFICAITONS Replace Section 099713 – Steel Water Storage Tank Coating of the technical specifications with the revised section attached herein as Attachment A. Questions and Answers Questions relating to the project must go directly to the City’s Public Works Contract Administration Division. The City is not responsible for any information obtained through other means. 1. Will only a C-33 license qualify as a prime bid? Correct. 2. Is there an existing tar liner within the tanks? No. 3. Do the existing coatings have lead based paint? The exterior coating at both tanks have tested positive for hazardous levels of lead. Refer to the technical specifications and associated bid item for further testing and abatement requirements. Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 Contract No. 5024-3A – PWS26-3918UTIL 3 Addendum No. 1 4. Is dehumidification required for the project. Yes, dehumidification systems shall be designed, permitted, furnished and installed by the contractor. Refer to technical specification 099713 for requirements. 5. Are there any existing electrical or water services available for the contractor’s use? No. Refer to technical specification 003119 for existing condition information. The Contractor shall provide all electrical power required to complete the work without connection to Carlsbad onsite power. Sound attenuation to meet the specified noise level shall apply to all equipment: air compressors, blowers, generators, dehumidification equipment. A District water source can be made available through the nearest fire hydrant to the site. If requested, the Contractor shall obtain a construction water meter permit through the city’s engineering front counter or online permit portal and pay all permit and metered fees. 6. Are door sheets permissible? Yes, a door sheet entry way is an acceptable means and method for entry. All costs associated with the door sheet shall be included in the contractors’ bid price. The awarded Contractor shall submit shop drawing detailing the dimensions of the cut and welds for approval by the engineer. 7. Do the welds need to be performed by a certified contractor? Yes. The contractor, or subcontractor, performing the welding shall hold a C-51 or C-60 license. Welder certifications are required to be submitted for approval. 8. Is the pre-bid mandatory and will the sign-in sheet be distributed to attendees? Yes, the pre-bid meeting is mandatory for contractors to submit a bid as a prime. Contractors shall have a representative attend the meeting and sign the sign-in sheet as proof of attendance. The sign-in sheet is available on the city’s Planet Bids portal, under the project’s ‘Documents’ tab. Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 Contract No. 5024-3A – PWS26-3918UTIL 4 Addendum No. 1 ATTACHMENT A Revised Technical Specification 099713 Steel Water Storage Tank Coating Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 SECTION 099713 STEEL WATER STORAGE TANK COATING ELM AND SKYLINE STEEL RESERVOIR COATING PROJECT CONTRACT 5024-3A 099713-1 PART 1 – GENERAL 1.1 DESCRIPTION A. This specification describes the requirements for surface preparation, application of protective coatings, curing, disinfection, water quality testing and the return of steel water storage tanks back to service. B. Tank coating materials and operations shall conform with AWWA D102 and as hereinafter specified. C. Work to be accomplished includes surface preparation, application of protective linings and coatings to interior and exterior surfaces, coordination with District inspector for monitoring and inspection of all surface preparation and coatings, testing of coatings, and all related work including handling of non-hazardous materials/wastes, installation of best management practices and environmental controls, and other work necessary to provide a complete coating system for the tank and all appurtenances, generally as follows: 1. Submit E-28 shutdown request form to District representative at least two weeks prior to the requested shutdown date. Elm and Skyline tanks shall be completed in consecutive order with only one tank taken out of service at a given time. The tank shall be returned to service prior to progressing to the next tank in series. 2. Remove and/or cover appurtenances not scheduled for coating. Such equipment includes, but is not limited to, water level indicator, signage, and electrical conduit. 3. Complete scheduled removals (interior ladder, tie down rods) and install appurtenances (interior bend fitting, safety railing, test port replacement, tie-down rods, etc.) scheduled for each tank. 4. Shim roof rafters to access void area between roof and rafter. 5. Test and abate lead based paint on tank exterior. Dispose of hazardous wastes generated in conformance with all regulations. 6. Abrasively blast per SSPC – SP10 all interior and exterior areas scheduled for coating. 7. Grind and clean corroded/damaged rafters. Remove damaged sealants/caulking. Route and clean surface area. 8. Wash down areas scheduled for coating. 9. Apply primer to all interior surfaces previously blast cleaned and apply coating system. Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 SECTION 099713 STEEL WATER STORAGE TANK COATING ELM AND SKYLINE STEEL RESERVOIR COATING PROJECT CONTRACT 5024-3A 099713-2 10. Conduct holiday testing of coating system and repair. Remove rafter shims once complete. 11. Apply a flexible sealant to all circumferential shell/roof connections, roof plate lap seams, and other crevices/voids that inhibit the coating application. 12. Apply primer to all exterior surfaces previously blast cleaned and then apply coating system. 13. Cure applied coatings. 14. Replace roof vent screens. Reinstall previously removed appurtenances. Remove covers from appurtenances not scheduled for coating. 15. Wash down coated interior surfaces. Disinfect complete interior of potable service tanks. Complete two rounds of Bac-T and VOC testing prior to returning tank to service. 16. Test, handle and dispose of any non-hazardous wastes generated from coating operations in conformance with all regulations. 1.2 REFERENCED SPECIFICATIONS AND STANDARDS A. Except as otherwise indicated, the current editions of the following apply to the Work of this Section. 1. American Society for Testing and Materials (ASTM) ASTM D3359, Standard Test Method for Measuring Adhesion by Tape. ASTM D4138, Standard Test Method for Measurement of Dry Paint Thickness of Protective Coating Systems by Destructive Means ASTM D4285, Standard Test Method for Indicating Oil or Water in Compressed Air ASTM D4414, Standard Practice for Measurement of Wet Film Thickness by Notch Gages ASTM D4417, Standard Test Methods for Field Measurement of Surface Profile of Blast Cleaned Steel ASTM D5402, Standard Test Methods for Assessing the Solvent Resistance of Organic Coatings Using Solvent Rubs ASTM D7091, Standard Practice for Nondestructive Measurement of Dry Film Thickness of Nonmagnetic Coatings Applied to Ferrous Metals and Nonmagnetic, Nonconductive Coatings Applied to Non-Ferrous Metals ASTM E337, Standard Test Method for Measuring Humidity with a Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 SECTION 099713 STEEL WATER STORAGE TANK COATING ELM AND SKYLINE STEEL RESERVOIR COATING PROJECT CONTRACT 5024-3A 099713-3 Psychrometer 2. American Water Works Association (AWWA) AWWA D102, AWWA Standard for Coating Steel Water Storage Tanks AWWA C652, AWWA Standard for Disinfection of Water Storage Facilities AWWA M42, AWWA Manual of Water Supply Practices, Steel Water Storage Tanks 3. SSPC: Society for Protective Coatings (SSPC) SSPC-SP 1, Solvent Cleaning SSPC-SP 2, Hand Tool Cleaning SSPC-SP 3, Power Tool Cleaning SSPC-SP 6, Commercial Blast Cleaning SSPC-SP 7, Brush-off Blast Cleaning SSPC-SP 10, Near-White Blast Cleaning SSPC-SP 11, Power Tool Cleaning to Bare Metal SSPC-SP 15, Power Tool Cleaning to Commercial Grade Cleanliness SSPC-PA 1, latest revision, for "Shop, Field and Maintenance Painting SSPC-PA 2, Measurement of Dry Film Thickness with Magnetic Gages SSPC-VIS 1, Visual Standard for Abrasive Blast Cleaned Steel SSPC-VIS 3, Visual Standard for Hand and Power Tool Cleaned Steel SSPC Publication No. 91-12, Coating and Lining Inspection Manual SSPC-Visual Comparison Manual SSPC Guide 6-2021 - Guide for Containing Surface Preparation Debris Generated During Paint Removal Operations SSPC Guide 12 - Guide for Illumination of Industrial Painting SSPC's Publication 91-12, Testing Recirculated Abrasives 4. NACE International (NACE) Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 SECTION 099713 STEEL WATER STORAGE TANK COATING ELM AND SKYLINE STEEL RESERVOIR COATING PROJECT CONTRACT 5024-3A 099713-4 NACE SP 0178, Standard Recommended Practice for fabrication Details, Surface Finish Requirements, and Proper Design Considerations for Tanks and Vessels to be Lined for Immersion Service. NACE SP 0188, Standard Recommended Practice for Discontinuity (Holiday) Testing of Protective Coatings 5. Painting and Decorating Contractors of America (PDCA) PDCA P2-04, Third Party Inspections: Qualifications, Responsibilities and Procedures. 6. U.S. Code of Federal Regulations 29 CFR 1926.55, Gases, Vapors, Fumes, Dusts, and Mists 29 CFR 1926.57, Safety and Health Regulations for Construction, Subpart D – Occupational Health and Environmental Controls (Ventilation) 7. California Code of Regulations 8CCR 5157, Permit Required Confined Spaces 8. National Sanitation Foundation (NSF) NSF 61 Drinking Water System Components – Health Effects NSF 600 Health Effects Solvent Criteria 1.3 SUBMITTALS A. The following shall be submitted in accordance with the General Provisions: 1. Qualifications of the Contractor and key personnel and project references (to be submitted with the bid). 2. Qualifications of the Contractor’s coating inspector and Certified Industrial Hygienist. 3. Health and Safety Plan, including surface preparation and coating operations. 4. Quality control plan for field coating operations and schedule of field coating activities. 5. Containment system for exterior abrasive blasting and coating operations. 6. Dehumidification and ventilation plan. Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 SECTION 099713 STEEL WATER STORAGE TANK COATING ELM AND SKYLINE STEEL RESERVOIR COATING PROJECT CONTRACT 5024-3A 099713-5 7. Equipment to be used for the measurement of dry film thickness, surface anchor profile, holiday detection, temperature and dew point. 8. Manufacturer’s paint color charts. 9. Product data and material safety data sheets for coating systems including, but not limited to paints, thinners, solvents, rust inhibitors and/or cleaning fluids. 10. Proof of certification of abrasive blast media from the California Air Resources Board list of Abrasive Blasting - Current Certified Abrasives. 11. Copy of regulatory agency permits that apply to the work of this Contract. 12. Product information for all appurtenances proposed for installation. 1.4 DEFINITIONS Action Level: Employee exposure, without regard to the use of respirators, to an airborne concentration of a contaminant in milligrams per cubic meter (mg/m3) or micrograms per cubic meter of air (μg/m3) calculated as an eight-hour Time Weighted Average (TWA). Unless otherwise specified by regulation, the Action Level of a material will be equivalent to one-half of the U.S. Department of Labor, Occupational Safety and Health Administration (OSHA) Permissible Exposure Limit (PEL) for that substance. Air Flow: In this guide, “air flow” refers to the rate or movement of air (i.e., foot per minute [ft/min]) in a given direction such as cross- or down-draft. Also referred to as “air velocity” or “air movement.” Coating: Protective materials used or applied on interior or exterior surfaces, or any protective material in general. Containment System: Cover panels, screens, tarps, scaffolds, supports and shrouds used to enclose an entire work area or a paint removal tool to minimize or prevent the debris generated during surface preparation from entering the environment, and to facilitate the controlled collection of the debris for disposal. Containment systems may also employ the use of ground covers or water booms. Emissions: Airborne plumes of material including abrasive media, paint chips and debris as well as spills or leaks of water. Engineering Controls: A device or system designed and implemented to restrict or abate occupational health and safety hazards at their source (e.g., ventilation to remove air contaminants, acoustical enclosure of noisy equipment). Exterior Surfaces: Exterior surfaces, excluding inaccessible areas, of the tank roof, shell, accessories and appurtenances that are exposed to the elemental atmosphere. Hazardous and Toxic Substances: Substances defined by OSHA as chemicals present in the workplace that are capable of causing harm. The term “chemicals” includes dusts, mixtures, and common materials such as paints, fuels, and solvents. Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 SECTION 099713 STEEL WATER STORAGE TANK COATING ELM AND SKYLINE STEEL RESERVOIR COATING PROJECT CONTRACT 5024-3A 099713-6 Impenetrable: Impervious to dust and wind. Impermeable: Impervious to water. Inaccessible Areas: Areas of the finished structure that, by virtue of the configuration of the completed structure, cannot be accessed to perform surface preparation or coating application (with or without the use of scaffolding, rigging, or staging). Inaccessible areas include such areas as the contact surfaces of roof plate lap joints, underside of roof plates where they cross supporting members, contact surfaces of bolted connections, underside of column base plates, contact surfaces of mating parts not intended to be removed or disassembled during routine operation or maintenance of the tank, and underside of the tank bottom for ground-supported flat-bottom tanks. Interior Surfaces: Surfaces of the tank or its appurtenances, accessories and appurtenances, that are exposed to the stored water or its vapor. Examples are the surfaces of the roof, support columns, space between roof and rafter, shell and bottom within the tank. Lining: Protective materials used or applied to interior surfaces. Manufacturer: The party that manufactures, fabricates, or produces materials or products. Negative Air Pressure: Air pressure inside a structure (e.g., containment) that is less than the air pressure outside the structure. Paint: Protective materials used or applied on exterior surfaces. Permissible Exposure Limit (PEL): PEL refers to employee exposure, without regard to the use of respirators, to an airborne concentration of a contaminant in micrograms per cubic meter of air (μg/m3) calculated as an eight-hour time-weighted average (TWA). A formula is used to calculate the PEL if an employee is exposed to lead or any other contaminant for more than eight hours in any workday. PM-10: Particulate matter (dust) less than 10 μm (0.39 mils) in aerodynamic equivalent diameter. (Aerodynamic equivalent diameter is defined as the diameter of a unit density sphere having the same settling velocity as the particle in question, regardless of its shape and density.) Potable water: Water that is safe and satisfactory for drinking and cooking. Pot-life: The time period, after mixing the components together, that the coating remains usable with no decrease in the desired properties or performance. Static Pressure: The pressure exerted by a liquid or gas, especially water or air, on a body at rest. As used herein, “static pressure” refers to the amount of pressure measured in inches of water when air moves through an object, such as duct work. Stripe Coat: a coat of paint applied to specified areas such as edges or welds before or after a full coat is applied to the entire surface. Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 SECTION 099713 STEEL WATER STORAGE TANK COATING ELM AND SKYLINE STEEL RESERVOIR COATING PROJECT CONTRACT 5024-3A 099713-7 Time Weighted Average (TWA): Concentrations of airborne toxic materials that have been weighted for a certain time duration, usually eight hours. Ventilation System: A method of providing air movement across a work area by either natural or mechanical means. Ventilation systems include both natural ventilation and mechanical ventilation (fans, hoods, and duct work) to provide air movement across the work area, and dust collectors to clean the discharged air. 1.5 QUALIFICATIONS A. The Contractor shall be a licensed Painting and Decorating Contractor in the State of California (C-33 Classification) and have a minimum of five (5) years of experience and successful history in the surface preparation and application of coating systems to the interior and exterior surfaces of steel water storage tanks of similar or larger size as the work of this Contract. B. Proof of certification under SSPC QP Certification Program must be submitted with the Contractors bid. Required certifications are: 1. SSOC-QP 1 2. SSPC-QP 2 C. Contractor shall substantiate the qualification requirements by furnishing a written list of project references and agency contacts with the bid as required by the Notice of Inviting Bids. D. Contractor shall submit resumes of the Contractor’s Representative and key personnel to be used on the project with the bid as required by the General Provisions. E. The Contractor’s containment and ventilation plan for tank surface preparation and coating operations shall be prepared by a California certified industrial hygienist. 1.6 WORKING HOURS A. The hours of work shall be as specified in the General Provisions. B. Inspection hours made necessary by the Contractor’s operations or to respond to emergencies outside of working hours shall be scheduled and approved by the Engineer. Inspections requested by, or made necessary by action or inaction of, the Contractor on Saturdays, Sundays or holidays must be scheduled, approved by the Engineer. Contractor shall pay for such occurrences at the prevailing rate for overtime or holiday work. 1.7 QUALITY ASSURANCE A. Quality assurance procedures and practices shall be utilized to monitor all phases of surface preparation and the application and inspection of coatings throughout the duration of the project. Procedures or practices not specifically defined herein may be utilized provided they meet recognized and acceptable professional Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 SECTION 099713 STEEL WATER STORAGE TANK COATING ELM AND SKYLINE STEEL RESERVOIR COATING PROJECT CONTRACT 5024-3A 099713-8 standards and are approved by the Engineer. The Contractor shall be held strictly to the requirement of the Specifications regarding quality of materials, workmanship, and diligent execution of the Contract. Surface preparation, coatings application and final approval may be evaluated by the District in accordance with the following standards, specifications or inspection procedures: 1. The coating manufacturer’s written product data sheets and PDCA P2-04, SSPC, NACE and/or ASTM D3276 standard practices. 2. Surface preparation and condition per NACE Standard RP0178. 3. Compressed air cleanliness per ASTM D4285. 4. Ambient conditions per ASTM E337. 5. Coating preparation, mixing, application and curing. Final visual appearance per SSPC PA1. 6. Wet film thickness per ASTMD4414 and dry film thickness per ASTM D1186 or SSPC-PA2. 7. Holiday detection in accordance with NACE RP0188 and AWWA D102. B. The Contractor shall maintain copies of SDSs at the jobsite at all times. C. Materials which have been stored over 60 days or beyond the manufacturer's recommended shelf life, whichever is less, will not be allowed. Copies of all invoices showing purchase and delivery dates for all materials mentioned above will be required. D. All materials furnished and all work accomplished under the Contract shall be subject to inspection by the Engineer. E. The District shall furnish and pay for the services of a full-time coating inspector during surface preparation and coating inspection of wet and dry coatings. F. Work accomplished in the absence of prescribed inspection may be ordered removed by the Engineer and replaced under proper inspection at the cost of the Contractor, regardless of whether the work removed is found to be defective or not. Concealed work shall, upon order of the District, be uncovered to the extent required and the Contractor shall bear the entire cost of accomplishing the work and furnishing all materials necessary for the removal of the covering and its subsequent replacement as directed by the Engineer. G. All surface preparation and priming operations accomplished offsite will be subject to inspection by the Owner’s appointed quality control inspector in accordance with the General Provisions. H. The District will make, or have made, such tests or inspections as it deems necessary to assure the work complies with the requirements of the Contract. Unless otherwise specified in the General Provisions, the cost of such testing will Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 SECTION 099713 STEEL WATER STORAGE TANK COATING ELM AND SKYLINE STEEL RESERVOIR COATING PROJECT CONTRACT 5024-3A 099713-9 be borne by the District. In the event such tests reveal non-compliance with the requirements of the Contract, the Contractor shall bear the cost of such corrective measures deemed necessary by the District, as well as the cost of subsequent retesting and re-inspection. Tests or inspections by the District shall not constitute an acceptance of any portion of the work or relieve the Contractor from compliance with the terms of the Contract. 1.8 WARRANTY INSPECTION A. A Warranty inspection shall be conducted prior to the twelfth month following completion of all work and filing of the Notice of Acceptance. All key personnel present at the Pre-Construction Conference should be present at this inspection. B. The District shall establish the date for the inspection and shall notify the Contractor at least 30 days in advance. The District will drain the tank and the Contractor shall provide, at his own expense, suitable lighting, scaffolding and ventilation for the inspection. For potable water tanks, and at the District's option, the warranty inspection for interior surfaces may be accomplished by diving operations with the tank in service. The District will raise water levels within the tank to the elevation of the overflow piping. The Contractor shall provide diving personnel and equipment to complete the warranty inspection of the tank interior. Remote Operation Vehicle (ROV) inspection is permissible. C. Interior Inspection: The entire interior coating systems shall be visually inspected and electrically tested in accordance with this specification and referenced standards. All defective or damaged coating or rust spots shall be satisfactorily repaired by and at the sole expense of the Contractor. All repaired areas shall then be electrically tested, and the repair and electrical testing procedure repeated until the surface conforms with the requirements herein. Defective coating shall be any of those defined by SSPC's Visual Comparison Manual. D. Exterior Inspection: The entire exterior paint system shall be visually inspected and electrically tested in accordance with this specification and referenced standards. All defective or damaged paint or rust spots shall be satisfactorily repaired by and at the sole expense of the Contractor. All repaired areas shall then be electrically tested, and the repair and electrical testing procedure repeated until the surface conforms with the requirements herein. Defective coating shall be any of those defined by SSPC's Visual Comparison Manual. E. The Contractor District shall prepare and deliver to the Contractor District an inspection report covering the warranty inspection, setting forth the number and type of failures observed, the percentage of the surface area where failure has occurred, and the names of the persons making the inspection. F. Upon delivery of the inspection report as noted herein, District and Contractor shall establish a date within 90 calendar days of delivery of the inspection report for the Contractor to complete any required remedial work. All work shall be repaired in accordance with this specification and to the satisfaction of the District. The District may proceed to have defects remedied as outlined in the General Provisions in the event of delay by the Contractor in commencing or completing such remedial work. Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 SECTION 099713 STEEL WATER STORAGE TANK COATING ELM AND SKYLINE STEEL RESERVOIR COATING PROJECT CONTRACT 5024-3A 099713-10 G. Any location where coating or paint has peeled, bubbled or cracked or where rusting is evident shall constitute failure of the system and will be subject to remedial work. The Contractor shall repair all such locations by removing the defective coating, cleaning the surface, and reapplying the specified coating system. If the area of failure exceeds 25 percent of a specific coated or painted surface, the entire applied system may be required to be removed and reapplied based on the District's sole judgment in accordance with this specification. H. Surfaces to be coated shall consist of and are defined as follows: 1. Roof interior 2. Roof support structure, including rafters, beams, girders and columns 3. Topside of roof rafter. Inaccessible area to be made accessible with roof shims. 4. Shell interior and all appurtenances, such as proposed bend fitting on inlet piping 5. Floor interior 6. Roof exterior 7. Shell exterior 8. Exterior appurtenances attached to tank and previously coated (ladder, railing, outlet piping, vent covers) 9. Attachments, accessories and appurtenances manufactured of carbon steel and that are not protected by other corrosion protection systems (galvanizing, powder coating, etc). I H. Upon completion of interior warranty remedial work, Contractor shall clean, disinfect and complete two consecutive passing bacterial and VOC tests for each tank as specified herein. J I. The Contractor shall bear all costs for warranty inspection and repair, and disinfection where required, and shall include such costs in the bid and no additional payment will be made by the District. 1.9 SAFETY AND HEALTH REQUIREMENTS A. The Contractor shall fully comply with California Code of Regulations pertaining to the work including, but not limited to, the following Construction Safety Orders (CSO) or General Industrial Safety Orders (GISO): 1. Illness Injury Prevention Program CSO/GISO 1508/3203 Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 SECTION 099713 STEEL WATER STORAGE TANK COATING ELM AND SKYLINE STEEL RESERVOIR COATING PROJECT CONTRACT 5024-3A 099713-11 2. Confined Space Plan GISO 5156/5159 3. Respiratory Protection CSO/GISO 1531/5144 4. Hazard Communication GISO 5194 5. Rolling Scaffolds CSO 1646 6. Employee Safety Instruction CSO 1510 7. Emergency Medical Service CSO 1512 8. Dusts, Fumes, Mists, Vapors & Gases CSO 1528 9. Fall Protection CSO 10. Hearing Conservation GISO B. The Contractor shall be responsible for the performance of all work in a safe and prudent manner, and to conform to all applicable safety requirements, regulations and guidelines of federal, state and local regulatory agencies, as well as applicable manufacturer's printed instructions, standards and technical bulletins and manuals. The following practices shall be employed by the Contractor: 1. The Contractor shall provide and require the use of personal protective equipment for the safety of all personnel and the Owner’s representative working in or about the project site. 2. The Contractor shall design ladders, scaffolding and rigging for their intended uses. Ladders and scaffolding shall be erected to facilitate inspection and be moved by the Contractor to locations requested by the District. 3. The Contractor shall provide proper ventilation, air eduction and exhausting of solvent vapors to reduce the concentration of air contaminants to a level which poses no hazard to personnel at or near the job site. Air circulation and exhausting of solvent vapors shall continue until coatings have fully cured. Forced air eduction during blast cleaning and coating operations is mandatory. Exhaust blower capacities shall be sufficient to maintain air changes within the tank interior in accordance with Cal-OSHA, coating manufacturer's recommendations and local air quality management district regulations. 4. Dehumidification equipment or other alternate ventilation systems must be approved by the Engineer. Equipment must be operated on a continuous basis during all blasting, coating and curing operations, including shifts during which no work is being accomplished. Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 SECTION 099713 STEEL WATER STORAGE TANK COATING ELM AND SKYLINE STEEL RESERVOIR COATING PROJECT CONTRACT 5024-3A 099713-12 5. Personal protective equipment shall be worn by all persons while in the vicinity of the work. During abrasive blasting operations, nozzlemen shall wear U.S. Bureau of Mines or National Institute of Occupational Safety and Health (NIOSH) approved positive pressure air-supplied helmets and all other persons who are exposed to blasting dust shall wear respiratory protection determined necessary by the exposure assessment of the Contractor’s Certified Industrial Hygienist. District reserves the right to review exposure assessment and to make additional recommendations. Positive pressure air-fed hoods and/or masks shall be supplied by an air source currently certified to produce "Class D Breathing Air". Contractor shall maintain current documentation onsite during the work to substantiate the quality of the breathing air. 6. All hoses shall be grounded to prevent accumulation of charges of static electricity. 7. Spark-proof artificial lighting shall be provided for all work in confined spaces. Light bulbs shall be guarded to prevent breakage. Lighting fixtures and flexible cords shall comply with the requirements of NFPA 70 "National Electric Code" for the atmosphere in which they will be used. When required by the Engineer, the Contractor shall provide additional illumination and necessary supports for inspection. The level of illumination for inspection purposes shall be determined by the Engineer or shall be based on GISO requirements; whichever is more stringent. 8. The maximum allowable concentration of vapor shall be kept below the maximum safe concentration for eight-hour exposure, plus Lower Explosive Limit (L.E.L.) must be strictly maintained. All regulations related to safety of personnel and handling and disposal of such materials shall be strictly followed and the costs for such activities shall be borne by the Contractor at no additional cost to the District. 9. When handling and mixing coating materials, workmen shall wear gloves and eye shields, at a minimum. Regulations regarding handling of exposed clothing shall be strictly enforced if working with lead or other heavy metals. 10. The Contractor shall provide fire abatement devices and prohibit any flames, welding and smoking during mixing and application of materials or curing periods in accordance with the coating system manufacturer instructions or applicable regulations. 11. Whenever the occupational noise exposure exceeds the maximum allowable sound levels, the Contractor shall provide and require the use of approved ear protective devices. a. Noise suppression measures shall be practiced at all times and must meet the requirements of local ordinances for noise at the property line. Such measures shall include, but not be limited to, equipping all internal combustion engines with critical residential silencers (mufflers), shielding noise-producing equipment from nearest areas of human occupancy by location in such positions as Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 SECTION 099713 STEEL WATER STORAGE TANK COATING ELM AND SKYLINE STEEL RESERVOIR COATING PROJECT CONTRACT 5024-3A 099713-13 to direct the greatest noise emissions away from such areas, and conducting operations in the most effective manner to minimize noise generation consistent with the prosecution of the Contract in a timely and economic manner. Whenever levels are objectionable, they shall be adjusted as directed by the Engineer. 1.10 COMPLIANCE WITH ENVIRONMENTAL REGULATORY REQUIREMENTS A. The Contractor shall comply with all current federal, state, and local environmental laws and regulations, including, but not limited to the laws and regulations of the U.S. Environmental Protection Agency (USEPA), the California Air Resources Board (CARB), and the San Diego County Air Pollution Control District (APCD). B. All abrasive blasting materials, coating system materials and surface preparation and coating equipment and practices shall comply with air pollution regulations, specifically the local air quality management district or air pollution control district rules: https://www.sdapcd.org/content/sdapcd/rules.html C. The Contractor shall furnish a copy all permits obtained from any regulatory agency that apply to the work of this Contract. PART 2 - PRODUCTS 2.1 GENERAL A. All materials shall be brought to the jobsite in the original sealed containers. They shall not be opened or used until District's representative has physically inspected the packaging and contents and obtained necessary data from container labels. B. All coating, paint and disinfection materials shall be stored in enclosed structures to protect them from weather and excessive heat or cold. Coatings or paints shall be protected from freezing. Materials exceeding the storage life recommended by the manufacturer shall be rejected. Copies of invoices showing purchase and delivery dates will be required. C. Flammability, toxicity, allergenic properties, and any other characteristic requiring field precautions shall be identified and specific safety practices shall be followed as required by federal, state, local manufacturer or SDSs. Flammable materials must be stored to conform with City, County, State and Federal safety codes for flammable materials. D. Coating materials shall conform to the applicable regulations and requirements of local, State and Federal air pollution regulatory agencies. Products containing perchlorethylene (PCE), trichloroethylene (TCE), lead or chromium will not be permitted. E. The Contractor shall use products of the same manufacturer for all coats. F. Substitutions required because of new VOC regulations shall be endorsed in writing from the materials manufacturer that these substituted materials will provide equivalent performance as those specified. Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 SECTION 099713 STEEL WATER STORAGE TANK COATING ELM AND SKYLINE STEEL RESERVOIR COATING PROJECT CONTRACT 5024-3A 099713-14 G. The District may require that the Contractor provide certified laboratory data showing the results of complete spectrographic and durability tests accomplished on the proposed substitute. Tests shall be accomplished by an independent testing laboratory approved by the Engineer and all costs incurred in the testing program shall be borne by the Contractor. In any case, the Engineer shall be sole and final judge of the acceptability of any proposed substitution. Requests for substitution must be approved in writing. H. Standard products of manufacturers other than those specified will be accepted when it is proved, to the satisfaction of the Engineer, they are equal in composition, durability and usefulness for the intended purpose. Substitutions will be considered provided the following minimum conditions are met: 1. A mixture of surfactant and water for wetting of the ACP and retardation of fiber. 2. The proposed coating or paint system shall employ coatings or paints of the same generic type. 3. The proposed coating or paint system shall have a dry film thickness equal to or greater than that of the specified system. 4. The proposed coating or paint system shall employ an equal or greater number of separate coats. 5. Requests for substitution shall include full descriptive literature and application instructions and complete information on generic type, non- volatile content by volume and a list of 10 similar projects, all at least three years in service, where the products have been applied to similar exposure. I. Prior to coating any surfaces of the tank, the Contractor shall provide written certifications from the coating manufacturers stating that the coating materials, thinners, solvents, and equipment cleaning fluids do not contain PCE or TCE. The Contractor shall also certify, in writing, that no material containing PCE, TCE, lead, or chromium in any form will be used for the interior coatings or exterior paints of the tank. J. The District may require all solvents, thinners and cleaning fluids be tested for TCE and PCE prior to being used at the job site. The Contractor shall provide the District with samples of each material at no cost to the District. Unacceptable materials shall be removed from the job site. 2.2 INTERIOR COATING SYSTEM A. Top coat color shall be white. 1. Floor and Bottom 6’’ of Shell: a. Prime Coat: MFG Zinc Primer or equal (NSF 61 certified in potable water service) at minimum Dry Film Thickness of 2.5 to 3.5 mils. Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 SECTION 099713 STEEL WATER STORAGE TANK COATING ELM AND SKYLINE STEEL RESERVOIR COATING PROJECT CONTRACT 5024-3A 099713-15 b. Stripe Coat: MFG SB Epoxy or equal at Dry Film Thickness of 3 to 4 mils. c. Top Coat: MFG 100% Solids Epoxy or equal at minimum Dry Film Thickness of 30 mils. d. Minimum dry film thickness of the completed system shall be 32 mils. 2. Shell and Roof a. Prime Coat: MFG Zinc Primert or equal (NSF 61 certified in potable water service) at minimum Dry Film Thickness of 2.5 to 3.5 mils. b. Stripe Coat: MFG SB Epoxy or equal at Dry Film Thickness of 3 to 4 mils. c. Intermediate Coat: MFG SB Epoxy at Dry Film Thickness of 5 to 8 mils. d. Topcoat MFG SB Epoxy at Dry Film Thickness of 5 to 8 mils. e. Minimum dry film thickness of the completed system shall be 12.5 mils. B. Carboline Alternate: 1. Floor and Bottom 6” of Shell: a. Prime Coat: Carbozinc 859 VOC or equal (NSF 61 certified in potable water service) at minimum Dry Film Thickness of 2.5 mils. b. Top Coat: Phenoline Tank Shield at minimum Dry Film Thickness of 30 mils. c. Minimum dry film thickness of the completed system shall be 32 mils. 2. Shell and Roof: a. Prime Coat: Carbozinc 859 VOC or equal (NSF 61 certified in potable water service) at minimum Dry Film Thickness of 2.5 mils. b. First Intermediate Coat: Carboguard 891 VOC at Dry Film Thickness of 4 to 6 mils. c. Second Intermediate Coat: Carboguard 891 VOC at Dry Film Thickness of 4 to 6 mils. d. Topcoat: Carboguard 891 VOC at Dry Film Thickness of 4 to 6 mils. Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 SECTION 099713 STEEL WATER STORAGE TANK COATING ELM AND SKYLINE STEEL RESERVOIR COATING PROJECT CONTRACT 5024-3A 099713-16 e. Minimum dry film thickness of the completed system shall be 15 mils. C. Sherwin Williams Alternate: 1. Floor and Bottom 6” of Shell: a. Prime Coat: Corothane 1 GalvaPac 2K at Dry Film Thickness of 2.5 mils. b. Top Coat: SherPlate PW Epoxy at minimum Dry Film Thickness of 30 mils. c. Minimum dry film thickness of the completed system shall be 32 mils. 2. Shell and Roof: a. Prime Coat: Corothane 1 GalvaPac 2K at minimum Dry Film Thickness of 2.5 mils. b. First Intermediate Coat: Macropoxy 5500LT at Dry Film Thickness of 4 to 6 mils. c. Second Intermediate Coat: Macropoxy 5500LT at Dry Film Thickness of 4 to 6 mils. d. Topcoat: Macropoxy 5500LT at Dry Film Thickness of 4 to 6 mils. e. Minimum dry film thickness of the completed system shall be 15 mils. D. Tnemec Alternate: 1. Floor and Bottom 6” of Shell: a. Prime Coat: Series 94-H2O Hydro-Zinc at Dry Film Thickness of 2.5 to 3.5 mils. b. Stripe Coat: Series L140F Pota-Pox Plus or Series 21 Epoxoline or equal at Dry Film Thickness of 3 to 4 mils. c. Top Coat: Series 22 Epoxoline at minimum Dry Film Thickness of 30 mils. d. Minimum dry film thickness of the completed system shall be 32 mils. 2. Shell and Roof: a. Prime Coat: Series 93-H2O or 94-H20 Hydro-Zinc at Dry Film Thickness of 2.5 to 3.5 mils. Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 SECTION 099713 STEEL WATER STORAGE TANK COATING ELM AND SKYLINE STEEL RESERVOIR COATING PROJECT CONTRACT 5024-3A 099713-17 b. Stripe Coat: Series L140F Pota-Pox or equal at Dry Film Thickness of 3 to 4 mils. c. Intermediate Coat: Series L140F Pota-Pox Plus at Dry Film Thickness of 5 to 8 mils. d. Topcoat: Series L140F Pota-Pox Plus at Dry Film Thickness of 5 to 8 mils. e. Minimum dry film thickness of the completed system shall be 12.5 mils. 3. Optional Tnemec High-Build Epoxy System For Shell And Roof a. Prime Coat: Series 93-H2O or 94-H2O Hydro-Zinc at Dry Film Thickness of 2.5to 3.5 mils. b. Stripe Coat: Series 21 Epoxoline or equal at Dry Film Thickness of 3 to 4 mils. c. Topcoat: Series 21 Epoxoline at minimum Dry Film Thickness of 10 to 16 mils applied in one or two coats. d. Minimum dry film thickness of the completed system shall be 12.5 mils. E. Joint sealant shall be an NSF 61 certified approved flexible polyurethane or polysulfide product, meeting Federal Specification TT-S-230. 2.3 EXTERIOR COATING SYSTEMS A. Exterior color shall match Tnemec AH22 “Buffalo Brown”. Finish color shall be selected by the District from color chart submitted by the Contractor at least three weeks prior to the start of painting operations. B. Carboline Alternate: 1. Prime Coat: Carbozinc 859 VOC at minimum Dry Film Thickness of 2.5 mils. 2. Intermediate Coat: Carboguard 890 VOC at minimum Dry Film Thickness of 4 to 6 mils. 3. Finish Coat: Carbothane 134 MC at minimum Dry Film Thickness of 4 to 6 mils. 4. Minimum dry film thickness of the completed system shall be 12 mils. C. Sherwin Williams Alternate: Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 SECTION 099713 STEEL WATER STORAGE TANK COATING ELM AND SKYLINE STEEL RESERVOIR COATING PROJECT CONTRACT 5024-3A 099713-18 1. Prime Coat: Corothane 1 GalvaPac 2K at minimum Dry Film Thickness of 2.5 mils. 2. Intermediate Coat: Macropoxy 646-100 at minimum Dry Film Thickness of 5 to 6 mils. 3. Finish Coat: Sher-Loxane 800 Polysiloxane at minimum Dry Film Thickness of 4 to 6 mils. 4. Minimum dry film thickness of the completed system shall be 12 mils. D. Tnemec Alternate: 1. Prime Coat: Series 93-H2O or 94-H2O Hydro-Zinc at Dry Film Thickness of 2.5 to 3.5 mils. 2. Stripe Coat: Series L140F Pota-Pox or Series 21 Epoxoline or equal at Dry Film Thickness of 3 to 4 mils. 3. Intermediate Coat: SeriesL140F Pota-Pox or V69F Epoxoline or Series 21 Epoxoline at Dry Film Thickness of 4 to 6 mils. 4. Finish Coat: 1095 Endura-Shield at Dry Film Thickness of 3 to 5 mils. 5. Minimum dry film thickness of the completed system shall be 12 mils. E. Exterior joint sealant shall be a flexible polyurethane or polysulfide product, similar or equal to Federal Specification TT-S-00230C, Type II, Class A (non-sag), Sikaflex 1A, Vulkem 921, Sonolastic NP1 or approved equal. Sealant color shall be approved by the District. 2.4 DISINFECTION MATERIALS A. Disinfection materials shall conform to all requirements of AWWA Standard C652, latest revision. B. Cleaner for pre-disinfection cleaning of interior surfaces shall be Grease Away or approved equal. 2.5 CONTAINMENT AND VENTILATION SYSTEMS A. The Contractor shall provide containment and ventilation systems which allow for the efficient containment of abrasive blast media, dust, paint and debris that will be generated during surface preparation and coating operations and comply with local air pollution control and federal health regulations. B. The 24-hour Respirable Particulate Matter (PM-10) shall not exceed the limits prescribed in California (50 μg/m3) or federal standards (150 μg/m3). The 24-hour standard is attained when the expected number of days per calendar year with a 24-hour average concentration above the specified limit is equal to or less than one. Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 SECTION 099713 STEEL WATER STORAGE TANK COATING ELM AND SKYLINE STEEL RESERVOIR COATING PROJECT CONTRACT 5024-3A 099713-19 C. For the California standard, the measurement method shall be Gravimetric or Beta Attenuation or any equivalent measurement method which can be shown to the satisfaction of the Air Resources Board to give equivalent results at or near the level of the air quality standard (CCR Title 17, Section 70200). For the federal standard, the measurement method shall be Inertial Separation and Gravimetric Analysis as described by the U.S. EPA or an equivalent method of measurement with a consistent relationship to the reference method and approved by the U.S. EPA. The Contractor shall conduct ambient air monitoring as described in SSPC- TU 7 and at a frequency as recommended by the Contractor’s Certified Industrial Hygienist to demonstrate compliance with air quality standards and in accordance with industry safe practices. D. The containment and ventilation systems shall conform with SSPC Guide 6 for Containment Classification 3A 1 and as follows: 1. Containment Materials: Type A2 – Flexible A1-Rigid 2. Containment Material Penetrability: Type B2a – Air Penetrable (tightly woven) B1-Impermeable 3. Support Structure: Type C1 – Rigid or Type C2 – Flexible Support 4. Joint Treatment: Type D2 – Partially Sealed Joints D1 – Fully Sealed Joints 5. Entryways: Type E3 – Entryway through Overlapping Door Tarps E1 – Zippered or Rigid Door Entry 6. Air Supply (Intake) Points: Type F2 – Open Air Flow F1 – Controlled Air Intakes 7. Input Air Flow: Type G2 – Natural Input Air Flow G2 – Forced Input Air Flow 8. Negative Air Pressure Inside Containment: H3 – Not Required H1 - Required 9. Air Movement: Type I2 – Minimum Air Movement is Not Specified I1 – Minimum Air Movement is Specified 10. Exhaust Air Flow/Dust Collection: Type J1 - Air Filtration Required HEPA Filtration Required E. The Contractor shall provide forced exhaust air ventilation during all coating removal, debris removal, and painting operation performed on the tank. All ventilation equipment shall be explosion proof. F. The containment and ventilation requirements stated are minimum requirements. The ventilation and containment systems shall be designed by a professional engineer qualified in industrial ventilation system design. The professional engineer shall visit the project site and confirm the systems are installed in accordance with the containment and ventilation plan and are functioning as intended or required. Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 SECTION 099713 STEEL WATER STORAGE TANK COATING ELM AND SKYLINE STEEL RESERVOIR COATING PROJECT CONTRACT 5024-3A 099713-20 G. When ventilation systems are required to meet the requirements of 29 CFR 1926.57, Containment Classification 2A or 1A shall be used. When negative pressure is required or specified, it shall be verified by instruments. H. The containment system shall be designed and erected to withstand live loads in accordance with the latest California Building Code adopted by the City and in such a manner that no damaging loads are imposed by the containment system on the structure to be painted. PART 3 - EXECUTION 3.1 GENERAL A. The work shall be completed at the Elm and Skyline tanks in consecutive order with only one tank taken offline at any given time. The tank shall be returned to service prior to progressing to the next tank in the series. B. All surface preparation, coating and paint application shall conform to applicable standards of the Society for Protective Coatings, the District and the manufacturer's printed instructions. Material applied prior to approval of the surface preparation by the District shall be removed and reapplied to the satisfaction of the District at the expense of the Contractor. Surfaces to be coated shall consist of and are defined as follows: 1. Roof interior 2. Roof support structure, including rafters, beams, girders and columns 3. Topside of roof rafter. Inaccessible area to be made accessible with roof shims. 4. Shell interior and all appurtenances, such as proposed bend fitting on inlet piping 5. Floor interior 6. Roof exterior 7. Shell exterior 8. Exterior appurtenances attached to tank and previously coated (ladder, railing, outlet piping, vent covers) 9. Attachments, accessories and appurtenances manufactured of carbon steel and that are not protected by other corrosion protection systems (galvanizing, powder coating, etc). C. Contractor shall notify the District prior to starting field surface preparation and coating application to coordinate and schedule a pre-application meeting. Attendance shall be required of all parties directly affecting the work of this section, Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 SECTION 099713 STEEL WATER STORAGE TANK COATING ELM AND SKYLINE STEEL RESERVOIR COATING PROJECT CONTRACT 5024-3A 099713-21 including the Agency’s representative, Applicator and Coating Manufacturer’s representative. The following items shall be reviewed: 1. Schedule for surface preparation and coating activities and coordination with other work. 2. Health and safety requirements 3. Environmental protection requirements 4. Field quality control 5. Protection of surfaces not scheduled to be coated 6. Surface preparation 7. Application and curing 8. Testing and repairs 9. Tank Cleaning 10. Tank Disinfection (potable water tanks only) 11. Protection of coating systems 12. Warranty inspection D. The Contractor’s representative shall be present at the work site during surface preparation, application, curing and disinfection operations. E. All work shall be accomplished by skilled craftsmen qualified to accomplish the required work in a manner comparable with the best standards of practice. F. The Contractor's equipment shall be designed for application of materials specified and shall be maintained in first class working condition. Compressors shall have suitable traps and filters to remove water and oils from the air. Blotter test shall be accomplished at each start-up period and as deemed necessary by the District. Contractor's equipment shall be subject to approval of the District. This approval does not relieve the Contractor's responsibility for the safe operation of the equipment or its performance. G. Cleanliness of compressed air supply shall be verified daily, and as deemed necessary by the District, by directing a stream of air, without abrasive, from the blast nozzle onto a white blotter or cloth for twenty seconds. If oil or water appears on the blotter or cloth, all traps and separators shall be blown down until two subsequent twenty-second tests show no further oil or water. H. Any equipment that is not in good working order or does not produce the results required by the specifications shall be removed from the site of the work upon the District’s request. Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 SECTION 099713 STEEL WATER STORAGE TANK COATING ELM AND SKYLINE STEEL RESERVOIR COATING PROJECT CONTRACT 5024-3A 099713-22 I. Application of the first coat shall follow immediately after surface preparation and cleaning within an eight-hour working day. Any cleaned areas not receiving the first coat within the time specified shall be recleaned prior to application of the first coat. If dehumidification equipment is used to control the area, cleaned areas may have the first coat applied during the last shift of the week, provided the dehumidification equipment has run continuously for at least 72 hours preceding the coating application and the surface and ambient conditions meet all requirements of the specification. J. Previously coated or painted surfaces shall be protected from moisture or contaminants in the atmosphere or recleaned prior to application of subsequent coat(s). Methods of protection and recleaning shall be approved by the District. K. The work shall cease, and corrective measures immediately taken if, in the opinion of the District, cleaning and application operations are creating a localized condition detrimental to ongoing facility activities, personnel or adjacent property. All additional costs created by shutdown shall be borne by the Contractor. L. The Contractor shall take all measures necessary to confine abrasive blasting debris, dust and/or coating or paint overspray to within the boundaries of the graded tank pad. The Contractor shall take all necessary precautions to prevent off-site contamination or consequences of its operations. Complaints received by the District relating to any such potential off-site problems will be directed to the Contractor’s representative and the Contractor shall immediately halt blast cleaning or application work and implement all measures necessary to correct any non-compliance with the specifications. All costs for the protection of off-site properties and/or correction of damage to property as a result of blast cleaning or application operations shall be borne directly by the Contractor at no additional cost to the District. M. District approval of Contractor's debris and overspray best management practices and District's presence on the project does relieve the Contractor from its responsibility to prevent migration of pollutants to off-site areas. Approval of prevention procedures will be required prior to the start of blasting or spray operations or in the event of any change in the procedures or the site conditions. 3.2 SURFACE PREPARATION – GENERAL A. The latest revision of the following surface preparation specifications of the Society for Protective Coatings shall form a part of this specification. (Note: An element of surface area is defined as any given square inch of surface). 1. Solvent Cleaning (SSPC-SP 1): Removal of oil, grease, soil and other contaminants by use of solvents, emulsions, cleaning compounds, steam cleaning or similar materials and methods, which involve a solvent or cleaning action. 2. Hand Tool Cleaning (SSPC-SP 2): Removal of loose rust, loose mill scale and other detrimental foreign matter present to degree specified by hand chipping, scraping, sanding and wire brushing. Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 SECTION 099713 STEEL WATER STORAGE TANK COATING ELM AND SKYLINE STEEL RESERVOIR COATING PROJECT CONTRACT 5024-3A 099713-23 3. Power Tool Cleaning (SSPC-SP 3): Removal of loose rust, loose mill scale and other detrimental foreign matter present to degree specified by power wire brushing, power impact tools or power sanders. 4. Commercial Blast Cleaning (SSPC-SP 6): Blast cleaning until at least two- thirds of each element of surface area is free of all visible residues. 5. Brush-off Blast Cleaning (SSPC-SP 7): Blast cleaning to remove loose rust, loose mill scale, and other detrimental foreign matter present to the degree specified. 6. Near-White Blast Cleaning (SSPC-SP 10): Blast cleaning to near-white metal cleanliness, until at least ninety-five percent of each element of surface area is free of all visible residues. 7. Power Tool Cleaning to Bare Metal (SSPC-SP 11): Power tool cleaning to produce a bare metal surface and to retain or produce a surface profile of at least 1.0 mil. 8. Low Pressure Water Cleaning (SSPC-SP 12, LPWC): Low pressure water cleaning at a maximum pressure of 5,000 PSI to remove loose rust, loose paint, and other detrimental foreign matter present. 9. Commercial Grade Powertool Cleaning (SSPC-SP 15): Powertool cleaning until at least two-thirds of each element of surface area is free of all visible residue. B. Prior to abrasive blast cleaning of the tank interior, welds in the bottom of the tank shall be vacuum tested in accordance with Section 13200. C. Tank interior coating and surfaces shall be abrasively blast cleaned to "Near-White Blast Cleaning" in conformance to SSPC's Surface Preparation Specification No. 10 (SSPC-SP 10) and a surface profile or anchor pattern of 2 to 3 mils. D. Tank exterior surfaces contain lead-based paint base coat and shall be removed and prepared per Sections 028319 and 028333. 3.3 SURFACE PREPARATION A. Examine areas and conditions under which coating systems are to be applied and notify the District of areas or conditions that are not acceptable. Do not begin surface preparation or application until unacceptable areas or conditions have been corrected. B. Slag, burrs, weld spatter, or sharp edges such as those created by flame cutting and shearing not previously removed shall be removed by chipping and grinding. All sharp edges shall be peened, ground or otherwise blunted in accordance with NACE SP 0178. It is not the intent to have the welds or "scars" ground "flush". The objective of the grinding is to eliminate sharp edges, corners, and overlaps to provide a surface for the application of a uniform thickness of coating or paint without voids, thin spots or other defects. Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 SECTION 099713 STEEL WATER STORAGE TANK COATING ELM AND SKYLINE STEEL RESERVOIR COATING PROJECT CONTRACT 5024-3A 099713-24 C. All interior surfaces exhibiting bare metal, rust, scaling, or damaged coatings shall be blast cleaned in accordance with Steel Structures Painting Council Specification No. 10 "Near-White Blast Cleaning," (SSPC-SP 10). Adjacent primer shall be firmly bonded to the substrate with blast cleaned edges feathered. D. All exterior surfaces exhibiting bare metal, rust, scaling, or damaged coatings shall be blast cleaned in accordance with Steel Structures Painting Council Specification No. 10 "Near-White Blast Cleaning," (SSPC-SP 10). Adjacent primer shall be firmly bonded to the substrate with blast cleaned edges feathered. E. After abrasive blast cleaning of damaged and defective areas and feathering of edges, cleaned areas will be primed as specified herein. Spot prime repairs will not be included as part of the intermediate coat. It is the intent of this specification to ensure a three-coat system is applied to all surfaces. F. Abrasive blasting nozzles shall be equipped with "deadman" emergency shut-off nozzles. Blast nozzle pressure shall be a minimum of 95 PSI and shall be verified with an approved nozzle pressure gage at each start-up period or as directed by the Engineer. G. All blast hose connections shall be tethered and connected with external couplings. These connections shall be taped with duct tape prior to pressurizing. All taped connections shall be visually inspected for leaks within five minutes after the start of blast cleaning operations each day and periodically throughout each day of operations. Leaking connections shall be immediately repaired. H. Field blast cleaning for all surfaces shall be by the dry method unless otherwise approved. The Contractor shall maintain dust emissions within the legal level and that level which would not create a nuisance. I. Particle size of abrasives used in blast cleaning shall be that which will produce the surface profile or anchor pattern specified herein or recommended by the manufacturer of the coating or paint system, subject to approval of the Engineer. J. Abrasive media used in blast cleaning operations shall be new, washed, graded and free of contaminants and shall not be reused unless specifically approved by the District. Abrasives shall be certified for unconfined dry blasting pursuant to the California Administrative Code, Section 92520 of Subchapter 6, Title 17, and shall appear on the current listing of approved abrasives. The Contractor shall submit invoices or load sheets confirming these requirements to the Engineer. K. Blast cleaned surfaces shall be cleaned prior to the application of coatings or paints by blowing with clean, dry air; brushing/brooming and/or vacuuming. Air hose for blowing shall be equipped with a shut-off device and shall meet GISO requirements. L. The surfaces of any non-carbon steel substrates or specialty items (i.e., galvanized, anodized, etc.) shall be properly treated and prepared prior to coating operations in accordance with the coating manufacturer's written recommendations, subject to approval of the Engineer. Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 SECTION 099713 STEEL WATER STORAGE TANK COATING ELM AND SKYLINE STEEL RESERVOIR COATING PROJECT CONTRACT 5024-3A 099713-25 M. Blast cleaning from rolling scaffolds shall only be accomplished within the confines of the scaffold. Reaching beyond the limits of scaffold perimeter will be allowed only if blast nozzle is maintained in a position which will produce a profile conforming to these specifications. N. The interior surfaces of the tank inlet/outlet nozzles shall be blast cleaned per these specifications. The Contractor shall protect isolation valves at the inlet and outlet nozzles, if mounted. All exposed surfaces of the valves shall be masked prior to blast cleaning the nozzles. O. During blast cleaning operations, the inlet, outlet, overflow and drain openings shall be covered with plywood bulkheads or other approved barriers to prevent entry of debris or other foreign materials. P. All welds shall be neutralized with a suitable chemical compatible with the specified coating materials when required or recommended by the coating system manufacturer. Q. The Contractor shall keep the work area in a clean condition and shall not permit blasting debris to accumulate to constitute a nuisance or hazard to the prosecution of the work, off-site contamination or the operation of the existing facilities. The ground surface around the tank perimeter shall be protected with a layer of polyethylene, minimum thickness of 6 mils. All debris generated and accumulated on the polyethylene shall be collected at the end of each day and disposed of in approved containers. R. Application for the necessary approvals and permits shall be made by the Contractor and coordinated with the Owner. All costs associated with the removal and disposal of debris shall be paid by the Contractor. S. Contractor shall be responsible for obtaining the certified laboratory test report and pay the costs necessary to determine if the residue generated during blasting and cleaning operations exceeds "leachable" limits for lead, arsenic, barium, cadmium, chromium, mercury, selenium and silver as determined by EPA's Toxicity Characteristic Leaching Procedure (TCLP). The laboratory must be certified by the State of California. A copy of the certified report shall be furnished to the Owner. T. Disposal of hazardous spent material is only allowed at a licensed hazardous waste disposal facility. The waste shall be transported to the facility by EPA approved licensed waste haulers. The disposal facility may require a sample of spent material for confirmation testing prior to receiving shipment. An EPA "Uniform Hazardous Waste Manifest" shall document each load of hazardous waste. The Contractor is directly and solely responsible for complying with the requirements of these hazardous waste laws in performing the work. U. Brush-Off Water Jet Blast Cleaning (SSPC-SP 12) shall be used only if approved by the Engineer and pressures shall be set to effectively remove loose, peeling/flaking coating or other surface contaminants. 1. SSPC SP12 and scarification of exterior surfaces may be required if the proximity of adjacent property dictates extraordinary precautions due to Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 SECTION 099713 STEEL WATER STORAGE TANK COATING ELM AND SKYLINE STEEL RESERVOIR COATING PROJECT CONTRACT 5024-3A 099713-26 potential for property damage. Sufficient rust inhibitor, approved by the paint manufacturer, shall be added to water to prevent rusting of cleaned surfaces prior to application of coatings. At the option of the Contractor, other methods of removal may be used, provided they protect adjacent properties, produce the required surface roughness and are approved by the Engineer. V. Remove and dispose all existing caulking from shell/roof junction, roof plate lap seams, designated void areas and interface between exterior floor plate and concrete ring wall (chime). 3.4 APPLICATION – GENERAL A. Coating and paint application shall conform to the requirements of the Society for Protective Coatings Paint Application Specification SSPC-PA 1, latest revision, for "Shop, Field and Maintenance Painting," the manufacturer of the coating and paint materials printed literature and as specified herein. B. No coating shall be applied under the following conditions: 1. When the surrounding air temperature or the temperature of the surface to be coated or painted is below 55 degrees F for epoxy coatings, below 45 degrees F for epoxy low temperature cure coatings, or above 110 degrees F for all materials. 2. On wet or damp surfaces or in rain, fog or mist. 3. When the temperature is less than 5 degrees F above the dew point. 4. When the air temperature is expected to drop below 55 degrees F for epoxy coating, below 45 degrees F for epoxy low temperature cure coatings, or less than 5 degrees F above the dew point within two hours or the manufactures specifications, which ever is longer, after application of coatings or paints. 5. When wind speeds exceed 15 miles per hour (for exterior operations only). C. If the above conditions exist or are forecast, coating application shall be delayed or postponed until conditions are favorable. The day's application shall be completed with sufficient time to permit sufficient drying time prior to damage by atmospheric conditions. D. Dew point shall be measured with a sling psychrometer in conjunction with U.S. Department of Commerce Weather Bureau Psychrometric Tables or approved dew point measurement equipment. E. Each coating or paint application shall be uniform in appearance and free of brush marks, sags, runs and no evidence of poor workmanship. Care should be exercised to avoid lapping on glass or hardware. Coatings and paints shall be Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 SECTION 099713 STEEL WATER STORAGE TANK COATING ELM AND SKYLINE STEEL RESERVOIR COATING PROJECT CONTRACT 5024-3A 099713-27 sharply cut to lines. Finished surfaces shall be free from blemishes or defects as defined by SSPC's Visual Comparison Manual. F. The wet film thickness of each coat shall be measured during application. Before application of successive coats, the dry film thickness shall be measured for compliance. G. Protective coverings or drop cloths shall be used to protect floors, fixtures, equipment, prepared surfaces and applied coatings or paints. Personnel entering the tank or walking on the tank roof shall take precautions to prevent damage or contamination of coated or painted surfaces. Personnel shall wear soft-soled shoes, or shoe coverings approved by the Engineer. Care shall be exercised to prevent coating or paint from being spattered onto surfaces which are not to be coated or painted. Surfaces from which such material cannot be removed satisfactorily shall be refinished to the satisfaction of the Engineer. H. All welds and irregular surfaces shall receive a stripe coat of the specified product prior to application of each intermediate coat. Coating shall be brushed in multiple directions to ensure penetration and coverage. These areas include, but are not limited to, welds, roof lap seams, nuts, bolts, pitted areas, ends and flanges of rafters and girders, etc. Ensure dry film thicknesses of coatings and paints conform with the requirements of the product manufacturer or these specifications, whichever is greater. I. At the conclusion of each day's blast cleaning and coating operations, a 6" wide strip of blast cleaned substrate shall remain uncoated as a marker for the following day's blast cleaning operations. J. Epoxy coated surfaces or other multi-component materials that are exposed to excessive sunlight or have exceeded the manufacturer's recommended time period for recoat shall be scarified by Brush-Off Blast Cleaning (SSPC SP 7) or methods approved by the Engineer prior to application of additional coating or paint. Scarified coating or paint shall have surface roughness as recommended by the coating manufacturer for mechanical bonding of the subsequent coat. K. All attachments, accessories, and appurtenances shall be prepared and finished in the same manner as specified for adjoining tank sections unless otherwise approved by the Engineer. L. After abrasive blast cleaning of damaged and defective areas and feathering of edges, cleaned areas will be primed as specified herein. Spot prime repairs will not be considered as a part of the intermediate coats. M. All coating components shall be mixed in exact proportions specified by the manufacturer. Care shall be exercised to ensure all material is removed from containers during mixing and metering operations. N. Coatings shall be thoroughly mixed with an approved slow-speed power mixer until all components are thoroughly combined and have a smooth consistency. Coatings shall not be applied beyond the pot-life or recoat period specified by the manufacturer. Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 SECTION 099713 STEEL WATER STORAGE TANK COATING ELM AND SKYLINE STEEL RESERVOIR COATING PROJECT CONTRACT 5024-3A 099713-28 O. Thinning shall only be permitted as recommended by the coating product manufacturer and in the presence of the Inspector. Thinners shall not exceed the limits set by applicable regulatory agencies. The Contractor shall be responsible for all costs for corrective work, fines or legal action resulting from the application of any materials which have been modified or thinned to such a degree as to cause them to exceed established VOC levels. P. Application shall be by conventional or airless spray method, except as otherwise approved. Drying time between coats shall be a minimum of 24 hours or in accordance with manufacturer's instructions. Q. When two or more coats are specified, each coat shall be of contrasting color or contain an approved color additive to indicate coverage of the applied coat. A fine bristle broom and air shall be used to remove dust and other matter from each coat prior to application of subsequent coats. R. Spray nozzles shall be held perpendicular and sufficiently close to the surface being coated to avoid excessive evaporation of volatile constituents, loss of material into the air or the bridging of cracks and crevices. Reaching beyond limits of scaffold perimeter will not be permitted. All overspray shall be removed by hand or pole sanding prior to application of subsequent coat. S. Joint sealant may be applied by caulking gun, trowel or other approved method. Sealant shall be pressed firmly into voids to achieve complete filling or sealing. T. All mixing, thinning, application and holiday detection of coatings shall be accomplished in the presence of the Inspector. U. A 7-day curing period at 70 degrees F and 50% relative humidity, or as recommended by the coating system manufacturer, shall occur before placing the epoxy coating into service. Refer to the dehumidification requirements of this specification. 3.5 APPLICATION – INTERIOR COATING SYSTEMS A. After completion of surface preparation as specified, the tank floor and the bottom 6 inches of shell shall receive the zinc/100% solids epoxy system and all other surfaces shall receive a three-coat zinc/epoxy system as specified in Part 2 of this specification. B. Shell/roof junction, roof plate lap seams, and designated void areas: 1. After completion of coating application, as specified, all void shall be filled with a joint sealant. Joint sealant may be applied by caulking gun, trowel or other approved method. Sealant shall be pressed firmly into voids to insure 100% filling/sealing. 3.6 APPLICATION – EXTERIOR PAINT SYSTEMS Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 SECTION 099713 STEEL WATER STORAGE TANK COATING ELM AND SKYLINE STEEL RESERVOIR COATING PROJECT CONTRACT 5024-3A 099713-29 A. After completion of surface preparation as specified, all surfaces shall receive three complete coats of one of the coating systems specified in Part 2 of this specification. B. Additional coats shall be applied in accordance with the coating manufacturer’s recoat period. Unless otherwise approved, a minimum of 12 hours shall elapse before applying subsequent coats. C. When cement mortar is not used between the tank floor and concrete ring wall foundation, and following all paint work, apply caulking to the gap between the exterior floor plate and concrete ring wall in accordance with the manufacturer’s written recommendations, using backing rod as required to provide suitable seal. Exterior caulking shall have a smooth clean finish. D. Contractor shall provide an enclosure system which allows for the efficient containment of sand, dust, paint, and debris what will be generated during blasting and painting operations. The containment system must be a proven method used previously on similar projects with acceptable results to contain the sand, dust, paint, and debris. E. Contractor shall provide a containment system that meets the requirements of SSPC Guide 61 and 18 for Containment Classification 3 with Class A-2 walls, Class B-2a-Air Penetrable (tightly woven), Class C-2 Flexible Support, Class D-2 Partially Sealed Joints, Class E-3 Entryway with Overlapping Door and Class F-2 Open Air Flow. and Section 2.5 of this specification. F. The containment shall be designed and erected in such a manner that no damaging loads are imposed by the containment system on the tank. G. Containment requirements given are minimum requirements. The Contractor shall provide a system that will contain the paint, abrasive media, dust, and debris within the property boundary of the tank. Protect all offsite property, equipment, and vehicles. 3.7 QUALITY CONTROL A. Surface preparation will be based upon comparison with: "Pictorial Surface Preparation Standards for Painting Steel Surfaces," SSPC-VIS 1 and as described herein. Anchor profile for prepared surfaces shall be measured by using a nondestructive instrument such as a Testex Press-O-Film System in accordance with ASTM D4417. Contractor must coordinate with District inspector to examine all surface preparation work. B. Wet film thickness testing shall be performed by the Contractor at regular intervals during the coating operation. Contractor must coordinate with District inspector for examination of work and spot checks of wet film thickness. Coatings shall be repaired following such testing. C. Dry film thickness of each coat will be measured by the District’s inspector. Holiday inspection must be performed by the Contractor and witnessed by the Inspector. Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 SECTION 099713 STEEL WATER STORAGE TANK COATING ELM AND SKYLINE STEEL RESERVOIR COATING PROJECT CONTRACT 5024-3A 099713-30 Contractor shall provide all inspection equipment and personnel to perform the inspections. D. Contractor shall furnish, until final acceptance of coating and painting, inspection devices in good working condition for detection of holidays and measurement of dry-film thickness of coatings. They shall also furnish National Institute of Standards and Technology/National Bureau of Standards (NIST/NBS) certified thickness calibration plates to test accuracy of thickness gauges. Gauge accuracy shall be verified, at a minimum, at the beginning and end of each work shift according to the procedures described in ASTM D7091 or more frequently if the gauge is dropped or suspected of giving erroneous readings during the work shift. Inspection devices shall be operated by, or in the presence of the Inspector with location and frequency basis determined by the District. The District may furnish its own inspection devices and render decisions based solely upon its tests. E. Film thickness testing of coatings shall be checked with a non-destructive film thickness gauge in accordance with ASTM D7091. Film thickness of flat (e.g., plate) surfaces shall be tested and the locations and frequency of the measurements shall conform with SSPC-PA 2. The acceptability of the measurements shall be evaluated for conformance with the dry film thickness requirements of this specification in accordance with SSPC-PA 2. An instrument such as Tooke Gage should be used in accordance with ASTM D4138 if a destructive test is deemed necessary. F. Upon completion of the interior coating operations and after the required curing interval, holiday detection shall be performed on all coated surfaces below the top capacity level with an approved inspection device in accordance with NACE SP 0188. Acceptable inspection devices include but are not limited to Tinker & Rasor Models AP and AP-W holiday detectors, and SSPC, Type II units for dry film thickness gauging. Inspection devices shall be calibrated and operated in accordance with the manufacturer's instructions and SSPC-PA 2. G. The holiday detection instrument shall be set at 100 volts/mil, include a wire brush electrode, and be properly grounded. The contractor shall obtain a letter from the coating manufacturer approving this test procedure, prior to any testing. Should the manufacturer not approve the use of a high-voltage testing device, a 67.5-volt device such as a Tinker & Rasor M-1 tester shall be used. H. A thorough visual inspection shall be completed on all surfaces above the top capacity level, including nuts, bolts, ends or edges of rafters, mating surfaces, etc. with any suspected holidays verified by holiday detection, as noted. I. All areas not meeting the specified dry film thickness and all holidays, pinholes or other defects shall be marked and repaired in accordance with the manufacturer's recommendations and this specification and retested. J. Upon completion of epoxy application to shell surfaces and abrasive blast cleaning of floor plates, and before application of epoxy to the tank floor, surfaces of completed epoxy coating on lower shell which may have been subjected to damage from abrasive blast cleaning of floor areas, shall be holiday detected again and repaired as specified herein. Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 SECTION 099713 STEEL WATER STORAGE TANK COATING ELM AND SKYLINE STEEL RESERVOIR COATING PROJECT CONTRACT 5024-3A 099713-31 K. The Contractor shall furnish illumination and scaffolding to permit inspection of all coated surfaces prior to acceptance of work. Contractor shall move lights and scaffolding as directed by the Inspector to enable inspection of all surfaces. 3.8 VENTILATION AND DEHUMIDIFICATION A. Ventilation systems used as an engineering control to reduce workers exposures to hazardous or toxic materials shall meet the requirements of 29 CFR 1926.57. B. For solvent-based coatings, provide ventilation during abrasive blasting and coating application and curing in confined or enclosed areas in accordance with AWWA D102-11, Section A.8.7. Forced air ventilation shall be maintained for a minimum of four (4) days following interior coating application. C. If dehumidification equipment is used, the equipment must run continuously during abrasive blasting, coating and curing. D. Dehumidification shall be used to continuously control the environment inside the tank during blast cleaning and to meet the requirements of the coating manufacturer. The system shall be meet the following requirements unless otherwise approved: E. Operation Criteria: 1. The Contractor shall design and submit for review a dehumidification and ventilation plan, which provides for a minimum cross-draft velocity of 100 feet per minute or down-draft velocity of 60 ft/min in the vicinity of the work area or as recommended by the professional engineer qualified in industrial ventilation system design considering project-specific conditions. The cross-draft velocities shall be obtained with the use of portable blower or fans. 2. The tank shall be continuously dehumidified 24 hours per day, 7 days per week during blasting, coating, between applications of coating, and until the system application is complete, until or unless approved otherwise in writing by the District. The equipment shall provide a relative humidity within the work space that does not exceed 35 percent, 24 hours per day. 3. The Contractor shall provide routine checks of the mechanical ventilation and dehumidification systems to ensure effective and continued performance. 4. The dehumidification system shall be operated and maintained at all times. Only ventilation equipment, not dehumidification equipment is required throughout the final cure period. 5. Dehumidification equipment shall also provide the necessary ventilation for the removal of solvent vapors during the coating. At all times, maintain the concentration of solvent vapors in all parts of the tank at 10-percent below the lower explosive limit (LEL). Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 SECTION 099713 STEEL WATER STORAGE TANK COATING ELM AND SKYLINE STEEL RESERVOIR COATING PROJECT CONTRACT 5024-3A 099713-32 F. Sizing of the ducting, ventilation, and dehumidification equipment shall be the sole responsibility of the Contractor. The recommended minimum diameter of ducting shall be 18 inches. Size of ducting shall be larger if deemed necessary by the Contractor to comply with these specifications or any local, state, or federal safety regulations. G. Ducting shall be airtight and reinforced with spirally-wound wire to prevent collapse. Provide an appropriate connecting device between the ducting and the designated opening. H. The surfaces that are to be blasted and coated shall not be exposed to a relative humidity over 35 percent. Furthermore, these areas shall not have a surface temperature that is less than 15 degrees F above dew point at any time during cleaning and coating phases. I. Equipment: 1. The dehumidification equipment shall be a solid desiccant (not liquid, granular, or loose lithium chloride) design having a single rotary desiccant bed capable of continuous operation, fully automatic, with drip-proof automatic electrical controller. 2. The equipment shall be capable of making two complete air changes every sixty minutes unless the 100 feet per minute cross-draft velocity requirement requires a larger volume. 3. The processed air from the dehumidification unit must maintain a relative humidity of 15 percent or less. 4. During the coating phase, dehumidification units shall have auxiliary heaters capable of maintaining a constant air temperature inside the tank meeting the requirements of the product manufacturer. Air heaters are not acceptable as substitutes for dehumidification units. 5. Air chillers, heaters, or air conditioners may be used downstream of the dehumidifiers if they are approved for use by the manufacturer of the dehumidification equipment and the Engineer. J. Dehumidification equipment shall be operating continuously, 24 hours a day, seven days per week from the time abrasive blasting begins, through to completion of all lining application. Equipment shall be turned off only for regular servicing or fueling of climate control equipment or generator(s). Equipment can be turned off during periods when there is no demand for dehumidification only if automatic controls are installed that perform the following: 1. Activates and deactivates the equipment by determining the difference between the coldest surface temperature and the dew point temperature in the tank. Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 SECTION 099713 STEEL WATER STORAGE TANK COATING ELM AND SKYLINE STEEL RESERVOIR COATING PROJECT CONTRACT 5024-3A 099713-33 2. Measures and logs surface temperature, inside air temperature, inside dew point temperature and equipment run time at 1-minute intervals. Copies of this data will be delivered to the Owner’s representative. 3.9 FINAL CURING OF INTERIOR EPOXY COATINGS A. Upon completion of applied coating system, Contractor shall furnish an approved exhaust fan or blower of sufficient capacity for removal of solvent vapors during the curing process. The fan or blower shall remain in continuous operation until coating is completely cured as determined by the coating manufacturer or a minimum of four (4) days, whichever is greater. The Contractor shall operate and maintain the blower continuously during the curing period. B. If dehumidification is being used, the equipment shall remain in-place and run continuously during all curing operations. C. After completion of curing as required by the coating manufacturer, the District’s inspector shall evaluate the final cure of the applied lining in accordance with the manufacturer’s recommended procedures, and ASTM D5402 to verify adequate curing has been attained. D. If final cure has not been attained, ventilation shall be continued until applied coating passes the solvent wipe test. E. After final cure is approved by the Engineer, the Contractor shall remove the fan or blower. 3.10 TANK CLEANING A. Cleaning shall be accomplished after completing and curing all interior recoating work and new coatings. B. The complete tank interior shall be cleaned with an approved cleaner or detergent applied via high pressure hot solution method. If deemed necessary by the District, surfaces shall be scrubbed with a brush or similar implement that will not damage the coatings to completely remove residual solvents or other contaminants. C. The surfaces shall then be rinsed with potable water. The residual water shall be thoroughly flushed from the tank. The Contractor shall obtain District approval prior to draining residual water to waste. 3.11 DISINFECTION A. The interior surfaces of potable water storage tanks shall be disinfected in accordance with AWWA C652, Section 4.2 Chlorination Method 2 as modified herein: 1. Disinfection shall be accomplished after completion and curing of all interior recoating work and new coatings. Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 SECTION 099713 STEEL WATER STORAGE TANK COATING ELM AND SKYLINE STEEL RESERVOIR COATING PROJECT CONTRACT 5024-3A 099713-34 2. Prior to disinfecting, the complete interior shall be cleaned with an approved cleaner or detergent applied via high pressure hot solution method. If deemed necessary by the District, surfaces shall be scrubbed with a fine bristle brush or similar implement which to completely remove residual solvents and other contaminants. 3. The surfaces shall then be rinsed with potable water. The residual water shall be thoroughly flushed from the tank. The Contractor shall obtain District approval prior to draining residual water to waste. 4. After completion of cleaning as noted above, all interior surfaces shall jet washed with a chlorine or chloramine solution having a concentration of 200 PPM. Chlorine or chloramine solution which accumulates on the bottom shall be dechlorinated and drained to waste after District approval. Rinsing with clean water is not required unless directed by the District. 5. Once the tank has been completely filled, the tank will be isolated from the water system and the Contractor shall take samples for bacteriological tests. Samples shall be taken immediately after filling the tank and a second sample after 24 hours. The tank is to remain out of service until the results pass California drinking water standards: absent for coliform bacteria and E. coli, and heterotrophic plate count (HPC) less than 500 colony-forming unit (CFU) per mL. The District may take additional samples for quality assurance testing 6. If the bacteriological tests fail, the Contractor will be responsible for reimbursing the District for the rejected and drained water and will be required to rechlorinate the reservoir as described above until the tests are negative. 3.12 TESTING FOR VOLATILE ORGANIC COMPOUNDS (VOC'S) A. VOC samples shall be taken by the Contractor to monitor the potential presence of VOC's that may have leached into the water. The following procedure shall be utilized: 1. After satisfactory disinfection, the water in the tank shall be retained for a period of 5 days. 2. On the sixth day, samples of water shall be taken by the Contractor in accordance with latest Health Department memoranda and delivered to an approved laboratory for testing of potential VOC's. The District may obtain additional samples for quality assurance testing. 3. The test results must show levels of leached organics to comply with levels established by the Health Department for various VOC's. Upon passing results, the tank will be placed into operating service by the District. 4. If concentrations of leached organics exceed regulatory levels, the tank shall be drained, flushed and refilled with potable water, and retested at the Contractor's expense. Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 SECTION 099713 STEEL WATER STORAGE TANK COATING ELM AND SKYLINE STEEL RESERVOIR COATING PROJECT CONTRACT 5024-3A 099713-35 3.13 CLEANUP A. Upon completion of the work, all surplus materials, containers, equipment and scaffolding shall be removed from the site. Containers with coatings, paints and thinners and all waste materials shall be disposed of offsite in accordance with applicable regulations. Spent abrasives from the blasting operation may not be dispersed on site. B. Coating or paint spots upon adjacent surfaces shall be removed and the entire jobsite cleaned. All damage to improvements or overspray on surfaces resulting from the work of this section shall be cleaned, repaired or refinished to the satisfaction of the District at no additional cost. END OF SECTION Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 5HYLVHG&RQWUDFW1R3DJHRI *(1(5$/3529,6,216 )25 :$7(55(6(592,5,03529(0(17352*5$0 (/0$1'6.</,1(67((/5(6(592,5&2$7,1*352-(&7 &2175$&712$ &$5/6%$'081,&,3$/:$7(5',675,&7 %,''(56$5($'9,6('7+$77+,66(&7,215(3/$&(63$57 *(1(5$/3529,6,2162)7+(67$1'$5'63(&,),&$7,216)25 38%/,&:25.6&216758&7,21 6(&7,217(506'(),1,7,216$%%5(9,$7,216$1' 6<0%2/6 7(506 8QOHVV RWKHUZLVH VWDWHG WKH ZRUGVdirected, required, permitted, ordered, instructed, designated, considered necessary, prescribed, approved, acceptable, satisfactory,RU ZRUGVRIOLNHPHDQLQJUHIHUWRDFWLRQVH[SUHVVLRQVDQGSUHURJDWLYHVRIWKH(QJLQHHU 5HIHUHQFH WR 'UDZLQJV :KHUH ZRUGV ³VKRZQ´ ³LQGLFDWHG´ ³GHWDLOHG´ ³QRWHG´ ³VFKHGXOHG´RUZRUGVRIVLPLODULPSRUWDUHXVHGLWVKDOOEHXQGHUVWRRGWKDWUHIHUHQFHLVPDGHWR WKHSODQVDFFRPSDQ\LQJWKHVHSURYLVLRQVXQOHVVVWDWHGRWKHUZLVH 'LUHFWLRQV:KHUHZRUGV³GLUHFWHG´³GHVLJQDWHG´³VHOHFWHG´RUZRUGVRIVLPLODULPSRUW DUHXVHGLWVKDOOEHXQGHUVWRRGWKDWWKHGLUHFWLRQGHVLJQDWLRQRUVHOHFWLRQRIWKH(QJLQHHULV LQWHQGHGXQOHVVVWDWHGRWKHUZLVH7KHZRUG³UHTXLUHG´DQGZRUGVRIVLPLODULPSRUWVKDOOEH XQGHUVWRRGWRPHDQ³DVUHTXLUHGWRSURSHUO\FRPSOHWHWKHZRUNDVUHTXLUHGDQGDVDSSURYHGE\ WKH(QJLQHHU´XQOHVVVWDWHGRWKHUZLVH (TXDOVDQG$SSURYDOV:KHUHWKHZRUGV³HTXDO´³DSSURYHGHTXDO´³HTXLYDOHQW´DQG VXFKZRUGVRIVLPLODULPSRUWDUHXVHGLWVKDOOEHXQGHUVWRRGVXFKZRUGVDUHIROORZHGE\WKH H[SUHVVLRQ ³LQ WKH RSLQLRQ RI WKH (QJLQHHU´ XQOHVV RWKHUZLVH VWDWHG :KHUH WKH ZRUGV ³DSSURYHG´³DSSURYDO´³DFFHSWDQFH´RUZRUGVRIVLPLODULPSRUWDUHXVHGLWVKDOOEHXQGHUVWRRG WKDWWKHDSSURYDODFFHSWDQFHRUVLPLODULPSRUWRIWKH(QJLQHHULVLQWHQGHG 3HUIRUP7KHZRUG³SHUIRUP´VKDOOEHXQGHUVWRRGWRPHDQWKDWWKH&RQWUDFWRUDWLWV H[SHQVH VKDOO SHUIRUPDOO RSHUDWLRQV ODERUWRROV DQG HTXLSPHQW DQG IXUWKHU LQFOXGLQJ WKH IXUQLVKLQJDQGLQVWDOOLQJRIPDWHULDOVWKDWDUHLQGLFDWHGVSHFLILHGRUUHTXLUHGWRPHDQWKDWWKH &RQWUDFWRUDWLWVH[SHQVHVKDOOIXUQLVKDQGLQVWDOOWKHZRUNFRPSOHWHDQGLQSODFHDQGUHDG\WR XVHLQFOXGLQJIXUQLVKLQJRIQHFHVVDU\ODERUPDWHULDOVWRROVHTXLSPHQWDQGWUDQVSRUWDWLRQ '(),1,7,2167KHIROORZLQJZRUGVRUJURXSVRIZRUGVVKDOOEHH[FOXVLYHO\GHILQHGE\ WKHGHILQLWLRQVDVVLJQHGWRWKHPKHUHLQ Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 5HYLVHG&RQWUDFW1R3DJHRI $GGHQGXP±:ULWWHQRUJUDSKLFLQVWUXPHQWLVVXHGSULRUWRWKHRSHQLQJRI%LGVZKLFKFODULILHV FRUUHFWVRUFKDQJHVWKHELGGLQJ RU &RQWUDFW 'RFXPHQWV 7KHWHUP $GGHQGXP VKDOO LQFOXGH EXOOHWLQVDQGDOORWKHUW\SHVRIZULWWHQQRWLFHVLVVXHGWRSRWHQWLDOELGGHUVSULRUWRRSHQLQJRI %LGV $JHQF\±7KH&LW\RI&DUOVEDG&DOLIRUQLDDQGRUWKH&DUOVEDG0XQLFLSDO:DWHU'LVWULFW $JUHHPHQW±6HH&RQWUDFW $VVHVVPHQW$FW&RQWUDFW±$&RQWUDFWILQDQFHGE\VSHFLDODVVHVVPHQWVDXWKRUL]HGXQGHUD 6WDWH$FWRUSURFHGXUDORUGLQDQFHRID&LW\RU&RXQW\ $YHUDJH6RXQG/HYHO±7KHOHYHOLQGHFLEHOVRIWKHPHDQVTXDUH$ZHLJKWHGVRXQGSUHVVXUH GXULQJDVWDWHGWLPHSHULRGZLWK UHIHUHQFH WR WKH VTXDUH RI WKH VWDQGDUG UHIHUHQFH VRXQG SUHVVXUHRIPLFURSDVFDOV7KHDYHUDJHVRXQGOHYHOLVHTXLYDOHQWWRWKHLQGXVWU\VWDQGDUG /HT6HH(TXLYDOHQW&RQWLQXRXV6RXQG/HYHO %DVH ± $ OD\HU RI VSHFLILHG PDWHULDO RI SODQQHG WKLFNQHVV SODFHG LPPHGLDWHO\ EHORZ WKH SDYHPHQWRUVXUIDFLQJ %LG±7KHRIIHURUSURSRVDORIWKH%LGGHUVXEPLWWHGRQWKHSUHVFULEHGIRUPVHWWLQJIRUWKWKH SULFHVIRUWKH:RUN %LGGHU±$Q\LQGLYLGXDOILUPSDUWQHUVKLSFRUSRUDWLRQRUFRPELQDWLRQWKHUHRIVXEPLWWLQJD%LG IRUWKH:RUNDFWLQJGLUHFWO\RUWKURXJKDGXO\DXWKRUL]HGUHSUHVHQWDWLYH %RDUG±7KHRIILFHURUERG\FRQVWLWXWLQJWKHDZDUGLQJDXWKRULW\RIWKH$JHQF\ZKLFKLVWKH&LW\ &RXQFLOIRUWKH&LW\RI&DUOVEDGRUWKH%RDUGRI'LUHFWRUVRI&DUOVEDG0XQLFLSDO:DWHU'LVWULFW %RQG±%LGSHUIRUPDQFHDQGSD\PHQWERQGRURWKHULQVWUXPHQWRIVHFXULW\ &DOWUDQV±7KH6WDWHRI&DOLIRUQLD'HSDUWPHQWRI7UDQVSRUWDWLRQ &DVK&RQWUDFW±$&RQWUDFWILQDQFHGE\PHDQVRWKHUWKDQVSHFLDODVVHVVPHQWV &HUWLILFDWH RI &RPSOLDQFH ± $ ZULWWHQ GRFXPHQW VLJQHG DQG VXEPLWWHG E\ D VXSSOLHU RU PDQXIDFWXUHUWKDWFHUWLILHVWKDWWKHPDWHULDORUDVVHPEOHGPDWHULDOVXSSOLHGWRWKH:RUNVLWH FRQIRUPVWRWKHUHTXLUHPHQWVRIWKH&RQWUDFW'RFXPHQWV &KDQJH2UGHU±$ZULWWHQRUGHUWRWKH&RQWUDFWRUVLJQHGE\WKH$JHQF\GLUHFWLQJDQDGGLWLRQ GHOHWLRQRUUHYLVLRQLQWKH:RUNRUDQDGMXVWPHQWLQWKH&RQWUDFW3ULFHRUWKH&RQWUDFWWLPH LVVXHGDIWHUWKHHIIHFWLYHGDWHRIWKH&RQWUDFW$&KDQJH2UGHUPD\RUPD\QRWDOVREHVLJQHG E\WKH&RQWUDFWRU &RGH±7KHWHUPVGovernment Code, Labor CodeHWFUHIHUWRFRGHVRIWKH6WDWHRI&DOLIRUQLD &RQVWUXFWLRQ0DQDJHU±WKH3URMHFW,QVSHFWRU¶VLPPHGLDWHVXSHUYLVRUDQGILUVWOHYHORIDSSHDO IRULQIRUPDOGLVSXWHUHVROXWLRQ &RQWUDFW±7KHZULWWHQDJUHHPHQWEHWZHHQWKH$JHQF\DQGWKH&RQWUDFWRUFRYHULQJWKH:RUN Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 5HYLVHG&RQWUDFW1R3DJHRI &RQWUDFW'RFXPHQWV±,QFOXGLQJEXWQRWOLPLWHGWR WKH&RQWUDFWDQ\$GGHQGXP ZKLFKSHUWDLQ WR WKH &RQWUDFW 'RFXPHQWV 1RWLFH ,QYLWLQJ %LGV ,QVWUXFWLRQVWR %LGGHUV %LG LQFOXGLQJ GRFXPHQWDWLRQDFFRPSDQ\LQJWKH%LGDQGDQ\SRVWELGGRFXPHQWDWLRQVXEPLWWHGSULRUWRWKH 1RWLFH RI $ZDUG ZKHQ DWWDFKHG DV DQ H[KLELW WR WKH &RQWUDFW WKH %RQGV WKH *HQHUDO 3URYLVLRQV SHUPLWV WKH 7HFKQLFDO 6SHFLILFDWLRQV WKH 6XSSOHPHQWDO 3URYLVLRQV WKH 3ODQV 6WDQGDUG3ODQV6WDQGDUG6SHFLILFDWLRQV5HIHUHQFH6SHFLILFDWLRQVDQGDOO0RGLILFDWLRQVLVVXHG DIWHUWKHH[HFXWLRQRIWKH&RQWUDFW &RQWUDFWRU±7KHLQGLYLGXDOSDUWQHUVKLSFRUSRUDWLRQMRLQWYHQWXUHRURWKHUOHJDOHQWLW\KDYLQJ D&RQWUDFWZLWKWKH$JHQF\WRSHUIRUPWKH:RUN,QWKHFDVHRIZRUNEHLQJGRQHXQGHUSHUPLW LVVXHGE\WKH$JHQF\WKHSHUPLWWHHVKDOOEHFRQVWUXFWHGWREHWKH&RQWUDFWRU7KHWHUP³SULPH FRQWUDFWRU´VKDOOPHDQ&RQWUDFWRU &RQWUDFW 7LPH 7KH QXPEHU RI :RUNLQJ 'D\V WR FRPSOHWH WKH :RUN DV VSHFLILHGLQWKH &RQWUDFW'RFXPHQWV &RQWUDFW3ULFH±7KHWRWDODPRXQWRIPRQH\IRUZKLFKWKH&RQWUDFWLVDZDUGHG &RQWUDFW8QLW3ULFH±7KHDPRXQWVWDWHGLQWKH%LGIRUDVLQJOHXQLWRIDQLWHPRIZRUN &RXQW\6HDOHU±7KH6HDOHURI:HLJKWVDQG0HDVXUHVRIWKHFRXQW\LQZKLFKWKH&RQWUDFWLV OHW &ULWLFDO 3DWK ± ,Q WKHFRQVWUXFWLRQ VFKHGXOH WKH VHTXHQFH RI DFWLYLWLHV WKDW UHSUHVHQWV WKH ORQJHVWSDWKWKURXJKWKH3URMHFWQHWZRUNRIDFWLYLWLHVDQGWKHVKRUWHVWSRVVLEOH3URMHFWGXUDWLRQ 'D\V±'D\VVKDOOPHDQFRQVHFXWLYHFDOHQGDU¶VGD\VXQOHVVRWKHUZLVHVSHFLILHG 'HFLEHO±$XQLWIRUPHDVXULQJWKHDPSOLWXGHRIVRXQGHTXDOWRWLPHVWKHORJDULWKPWRWKH EDVHRIWKHUDWLRRIWKHSUHVVXUHRIWKHVRXQGPHDVXUHGWRWKHUHIHUHQFHSUHVVXUHZKLFKLV PLFURSDVFDOV 'HIHFWLYH:RUN:RUNWKDWGRHVQRWFRQIRUPWRWKHUHTXLUHPHQWVRIWKH&RQWUDFW'RFXPHQWV 'HSXW\ &LW\ (QJLQHHU± 7KH (QJLQHHULQJ 0DQDJHU RI WKH &RQVWUXFWLRQ 0DQDJHPHQW ,QVSHFWLRQ'HSDUWPHQWWKH&RQVWUXFWLRQ0DQDJHU¶VLPPHGLDWHVXSHUYLVRUDQGWKH(QJLQHHU¶V GHVLJQDWHGUHSUHVHQWDWLYH7KH'HSXW\&LW\(QJLQHHULVWKHVHFRQGOHYHORIDSSHDOIRULQIRUPDO GLVSXWHUHVROXWLRQ 'LVSXWH%RDUG±3HUVRQVGHVLJQDWHGE\WKH&LW\0DQDJHURIWKH&LW\RI&DUOVEDGRU([HFXWLYH 0DQDJHU RIWKH &DUOVEDG0XQLFLSDO:DWHU 'LVWULFW WR KHDU DQG DGYLVH WKH &LW\0DQDJHU RQ FODLPVVXEPLWWHGE\WKH&RQWUDFWRU7KH&LW\0DQDJHUIRUWKH&LW\RI&DUOVEDGRUWKH([HFXWLYH 0DQDJHUIRUWKH&DUOVEDG0XQLFLSDO:DWHU'LVWULFWLVWKHODVWDSSHDOOHYHOIRULQIRUPDOGLVSXWH UHVROXWLRQ 'LVSXWHG:RUN±:RUNLQZKLFKWKH$JHQF\DQGWKH&RQWUDFWRUDUHLQGLVDJUHHPHQW (OHFWUROLHU ± 6WUHHW OLJKW DVVHPEO\ FRPSOHWH LQFOXGLQJ IRXQGDWLRQ VWDQGDUG OXPLQDLUH DUP OXPLQDLUHHWF Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 5HYLVHG&RQWUDFW1R3DJHRI (QJLQHHU±7KH&LW\(QJLQHHURIWKH&LW\RI&DUOVEDGRUKLVKHUDSSURYHGUHSUHVHQWDWLYH7KH (QJLQHHULVWKHWKLUGOHYHORIDSSHDOIRULQIRUPDOGLVSXWHUHVROXWLRQ (QJLQHHU RI 5HFRUG'HVLJQ (QJLQHHU ±$UHJLVWHUHG SURIHVVLRQDO HQJLQHHU OLFHQVHG LQ WKH 6WDWHRI&DOLIRUQLDZKRLVTXDOLILHGWRDFWDVDQDJHQWRIDSURMHFWRZQHURUWRSUHSDUHSODQVIRU IDFLOLWLHVWREHDFFHSWHGE\WKH&LW\RI&DUOVEDG7KHWHUPLQFOXGHVSHUVRQVOLFHQVHGLQWKH6WDWH RI&DOLIRUQLDDV&LYLO(QJLQHHUVRU6WUXFWXUDO(QJLQHHUV (TXLYDOHQW&RQWLQXRXV6RXQG/HYHO /HT ±7KHDYHUDJHVRXQGOHYHOZKLFKRYHUDJLYHQ SHULRGRIWLPHKDVWKHVDPHWRWDOHQHUJ\DVWKHIOXFWXDWLQJQRLVHDQGLVDOVRNQRZQDVWKHWLPH DYHUDJHVRXQGOHYHO ([WUD:RUN±1HZRUXQIRUHVHHQZRUNQRWFRYHUHGE\D&RQWUDFW8QLW3ULFHRU6WLSXODWHG8QLW 3ULFH )ORDW±7KHQXPEHURIGD\VE\ZKLFKDQDFWLYLW\LQWKHFRQVWUXFWLRQVFKHGXOHPD\EHGHOD\HG IURPHLWKHULWVHDUOLHVWVWDUWGDWHRUHDUOLHVWFRPSOHWLRQGDWHZLWKRXWH[WHQGLQJWKH&RQWUDFW7LPH WRWDOIORDW 7RWDOIORDWEHORQJVWRWKH3URMHFWDQGWRDQ\3DUW\WRDFFRPPRGDWHFKDQJHVLQWKH :RUNRUWRPLWLJDWHWKHHIIHFWRIHYHQWVZKLFKPD\GHOD\FRPSOHWLRQ +ROLGD\±+ROLGD\VDQGWKHGD\VREVHUYHGDUHOLVWHGEHORZ,IDKROLGD\IDOOVRQD6DWXUGD\WKH KROLGD\LVREVHUYHGRQWKHSUHFHGLQJ)ULGD\,IWKHKROLGD\IDOOVRQD6XQGD\LWLVREVHUYHGWKH IROORZLQJ0RQGD\8QOHVVVSHFLILHGRWKHUZLVHLQWKH&RQWUDFW'RFXPHQWVRUDXWKRUL]HGE\WKH (QJLQHHUGRQRWZRUNRQKROLGD\V 1HZ<HDU¶V'D\-DQXDU\ 0DUWLQ/XWKHU.LQJ'D\UG0RQGD\LQ-DQXDU\ 3UHVLGHQWV¶'D\UG0RQGD\LQ)HEUXDU\ 0HPRULDO'D\/DVW0RQGD\LQ0D\ ,QGHSHQGHQFH'D\-XO\ /DERU'D\VW0RQGD\LQ6HSWHPEHU ,QGLJHQRXV3HRSOHV¶'D\QG0RQGD\LQ2FWREHU 9HWHUDQ¶V'D\1RYHPEHU 7KDQNVJLYLQJ'D\WK7KXUVGD\LQ1RYHPEHU 7KDQNVJLYLQJ)ULGD\'D\DIWHU7KDQNVJLYLQJ &KULVWPDV'D\'HFHPEHU +RXVH &RQQHFWLRQ 6HZHU ± $ VHZHU ZLWKLQ D SXEOLF VWUHHW RU ULJKWRIZD\ SURSRVHG WR FRQQHFWDQ\SDUFHOORWRUSDUWRIDORWZLWKDPDLQOLQHVHZHU +RXVH6HZHU±$VHZHUZKROO\ZLWKLQSULYDWHSURSHUW\SURSRVHGWRFRQQHFWDQ\EXLOGLQJWRD KRXVHFRQQHFWLRQVHZHU /XPLQDLUH±7KHODPSKRXVLQJLQFOXGLQJWKHRSWLFDODQGVRFNHWDVVHPEOLHV DQGEDOODVWLIVR VSHFLILHG /XPLQDLUH $UP ± 7KH VWUXFWXUDO PHPEHU EUDFNHW RU PDVW DUP ZKLFK PRXQWHGRQ WKH VWDQGDUGVXSSRUWVWKHOXPLQDLUH 0LQRU%LG,WHP±DVLQJOHFRQWUDFWLWHPFRQVWLWXWLQJOHVVWKDQSHUFHQW RIWKHRULJLQDO &RQWUDFW3ULFHELG Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 5HYLVHG&RQWUDFW1R3DJHRI 0RGLILFDWLRQ±,QFOXGHV&KDQJH2UGHUVDQG6XSSOHPHQWDO$JUHHPHQWV$0RGLILFDWLRQPD\ RQO\EHXVHGDIWHUWKHHIIHFWLYHGDWHRIWKH&RQWUDFW 1LJKW:RUN±6HH:RUNLQJ1LJKW 1RWLFHRI$ZDUG±7KHZULWWHQQRWLFHE\WKH$JHQF\WRWKHVXFFHVVIXO%LGGHUVWDWLQJWKDWXSRQ FRPSOLDQFHE\LWZLWKWKHUHTXLUHGFRQGLWLRQVWKH$JHQF\ZLOOH[HFXWHWKH&RQWUDFW 1RWLFHWR3URFHHG±$ZULWWHQQRWLFHJLYHQE\WKH$JHQF\WRWKH&RQWUDFWRUIL[LQJWKHGDWHRQ ZKLFKWKH&RQWUDFWWLPHZLOOVWDUW 2ZQ2UJDQL]DWLRQ:KHQXVHGLQ6HFWLRQVDQG±(PSOR\HHVRIWKH&RQWUDFWRU ZKRDUHKLUHGGLUHFWHGVXSHUYLVHGDQGSDLGE\WKH&RQWUDFWRUWRDFFRPSOLVKWKHFRPSOHWLRQRI WKH :RUN )XUWKHU VXFK HPSOR\HHV KDYH WKHLU HPSOR\PHQW WD[HV6WDWH GLVDELOLW\ LQVXUDQFH SD\PHQWV 6WDWH DQG )HGHUDO LQFRPH WD[HV SDLG DQG DGPLQLVWHUHG DV DSSOLFDEOH E\ WKH &RQWUDFWRU)XUWKHU³RZQRUJDQL]DWLRQ´PHDQVFRQVWUXFWLRQHTXLSPHQWWKDWWKH&RQWUDFWRURZQV RU OHDVHV DQG XVHV WR DFFRPSOLVK WKH :RUN (TXLSPHQW WKDW LV RZQHU RSHUDWHG RU OHDVHG HTXLSPHQWZLWKDQRSHUDWRULVQRWSDUWRIWKH&RQWUDFWRU V2ZQ2UJDQL]DWLRQDQGZLOOQRWEH LQFOXGHGIRUWKHSXUSRVHRIFRPSOLDQFHZLWK6HFWLRQVDQG 3HUVRQ±$Q\LQGLYLGXDOILUPDVVRFLDWLRQSDUWQHUVKLSFRUSRUDWLRQWUXVWMRLQWYHQWXUHRURWKHU OHJDOHQWLW\ 3ODQV±7KHGUDZLQJVSURILOHVFURVVVHFWLRQVZRUNLQJGUDZLQJVDQGVXSSOHPHQWDOGUDZLQJV RU UHSURGXFWLRQV WKHUHRI DSSURYHG E\ WKH (QJLQHHU ZKLFK VKRZWKH ORFDWLRQ FKDUDFWHU GLPHQVLRQVRUGHWDLOVRIWKH:RUN 3ULYDWH&RQWUDFW±:RUNVXEMHFWWR$JHQF\LQVSHFWLRQFRQWURODQGDSSURYDOLQYROYLQJSULYDWH IXQGVQRWDGPLQLVWHUHGE\WKH$JHQF\ 3URMHFW ,QVSHFWRU ± WKH (QJLQHHU¶V GHVLJQDWHG UHSUHVHQWDWLYH IRU LQVSHFWLRQ FRQWUDFW DGPLQLVWUDWLRQDQGILUVWOHYHOIRULQIRUPDOGLVSXWHUHVROXWLRQ 3URSRVDO±6HH%LG 5HIHUHQFH 6SHFLILFDWLRQV ± 7KRVH EXOOHWLQV VWDQGDUGV UXOHV PHWKRGV RI DQDO\VLV RU WHVW FRGHV DQGVSHFLILFDWLRQVRIRWKHUDJHQFLHVHQJLQHHULQJVRFLHWLHVRULQGXVWULDODVVRFLDWLRQV UHIHUUHGWRLQWKH&RQWUDFW'RFXPHQWV7KHVHUHIHUWRWKHODWHVWHGLWLRQLQFOXGLQJDPHQGPHQWV LQ HIIHFW DQG SXEOLVKHG DW WKH WLPH RI DGYHUWLVLQJ WKH SURMHFW RU LVVXLQJ WKH SHUPLW XQOHVV VSHFLILFDOO\UHIHUUHGWRE\HGLWLRQYROXPHRUGDWH 5RDGZD\±7KHSRUWLRQRIDVWUHHWUHVHUYHGIRUYHKLFXODUXVH 6HUYLFH&RQQHFWLRQ±6HUYLFHFRQQHFWLRQVDUHDOORUDQ\SRUWLRQRIWKHFRQGXLWFDEOHRUGXFW LQFOXGLQJPHWHUEHWZHHQDXWLOLW\GLVWULEXWLRQOLQHDQGDQLQGLYLGXDOFRQVXPHU 6HZHU ± $Q\FRQGXLW LQWHQGHGIRUWKH UHFHSWLRQ DQG WUDQVIHU RI VHZDJH DQG IOXLG LQGXVWULDO ZDVWH Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 5HYLVHG&RQWUDFW1R3DJHRI 6KRS 'UDZLQJV ± 'UDZLQJV VKRZLQJ WKH GHWDLOV RI PDQXIDFWXUHG RU DVVHPEOHG SURGXFWV SURSRVHGWREHLQFRUSRUDWHGLQWRWKH:RUN 6RXQG/HYHO±7KHZHLJKWHGVRXQGSUHVVXUHOHYHOREWDLQHGXVLQJDVRXQGOHYHOPHWHUDQG IUHTXHQF\ZHLJKWLQJQHWZRUNDVSURYLGHGLQWKH$PHULFDQ1DWLRQDO6WDQGDUGV,QVWLWXWH $16, VSHFLILFDWLRQVIRUVRXQGOHYHOPHWHUV6RXQGOHYHOPHDQVWKHVDPHDVQRLVHOHYHO 6SHFLDO 3URYLVLRQV ± 5HYLVLRQV WR WKH 6WDQGDUG 6SHFLILFDWLRQV VHWWLQJ IRUWK FRQGLWLRQV DQG UHTXLUHPHQWVSHFXOLDUWRWKH:RUN 6SHFLILFDWLRQV ± *HQHUDO 3URYLVLRQV 6WDQGDUG 6SHFLILFDWLRQV 7HFKQLFDO 6SHFLILFDWLRQV 5HIHUHQFH 6SHFLILFDWLRQV 6XSSOHPHQWDO 3URYLVLRQV DQG VSHFLILFDWLRQV LQ 6XSSOHPHQWDO $JUHHPHQWVEHWZHHQWKH&RQWUDFWRUDQGWKH%RDUG 6WDQGDUG±7KHVKDIWRUSROHXVHGWRVXSSRUWVWUHHWOLJKWLQJOXPLQDLUHWUDIILFVLJQDOKHDGVPDVW DUPVHWF 6WDQGDUG3ODQV±'HWDLOVRIVWDQGDUGVWUXFWXUHVGHYLFHVRULQVWUXFWLRQVUHIHUUHGWRRQWKH 3ODQVRULQ6SHFLILFDWLRQVE\WLWOHRUQXPEHU 6WDQGDUG 6SHFLILFDWLRQV ± 7KH 6WDQGDUG 6SHFLILFDWLRQV IRU 3XEOLF :RUNV &RQVWUXFWLRQ 663:& WKH³*UHHQERRN´ 6WDWH±6WDWHRI&DOLIRUQLD 6WLSXODWHG8QLW3ULFH±8QLWSULFHVHVWDEOLVKHGE\WKH$JHQF\LQWKH&RQWUDFW'RFXPHQWV 6WRUP'UDLQ±$Q\FRQGXLWDQGDSSXUWHQDQFHVLQWHQGHGIRUWKHUHFHSWLRQDQGWUDQVIHURIVWRUP ZDWHU 6WUHHW±$Q\URDGKLJKZD\SDUNZD\IUHHZD\DOOH\ZDONRUZD\ 6XEEDVH ± $ OD\HU RI VSHFLILHG PDWHULDO RI SODQQHG WKLFNQHVV EHWZHHQ D EDVH DQG WKH VXEJUDGH 6XEFRQWUDFWRU±$QLQGLYLGXDOILUPRUFRUSRUDWLRQKDYLQJDGLUHFWFRQWUDFWZLWKWKH&RQWUDFWRU RUZLWKDQ\RWKHU6XEFRQWUDFWRUIRUWKHSHUIRUPDQFHRIDSDUWRIWKH:RUN 6XEJUDGH±)RUURDGZD\VWKDWSRUWLRQRIWKHURDGEHGRQZKLFKSDYHPHQWVXUIDFLQJEDVH VXEEDVHRUDOD\HURIRWKHUPDWHULDOLVSODFHG)RUVWUXFWXUHVWKHVRLOSUHSDUHGWRVXSSRUWD VWUXFWXUH 6XSHUYLVLRQ±6XSHUYLVLRQZKHUHXVHGWRLQGLFDWHVXSHUYLVLRQE\WKH(QJLQHHUVKDOOPHDQWKH SHUIRUPDQFHRIREOLJDWLRQVDQGWKHH[HUFLVHRIULJKWVVSHFLILFDOO\LPSRVHGXSRQDQGJUDQWHGWR WKH $JHQF\ LQ EHFRPLQJ D SDUW\ WR WKH &RQWUDFW ([FHSW DV VSHFLILFDOO\ VWDWHG KHUHLQ VXSHUYLVLRQE\WKH$JHQF\VKDOOQRWPHDQDFWLYHDQGGLUHFWVXSHULQWHQGHQFHRIGHWDLOVRIWKH :RUN 6XSSOHPHQWDO$JUHHPHQW±$ZULWWHQDPHQGPHQWRIWKH&RQWUDFW'RFXPHQWVVLJQHGE\ERWK SDUWLHV Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 5HYLVHG&RQWUDFW1R3DJH RI 6XSSOHPHQWDO3URYLVLRQV±6HH6SHFLDO3URYLVLRQV 6XUHW\ ± $Q\ LQGLYLGXDO ILUP RU FRUSRUDWLRQ ERXQG ZLWK DQG IRU WKH &RQWUDFWRU IRU WKH DFFHSWDEOHSHUIRUPDQFHH[HFXWLRQDQGFRPSOHWLRQRIWKH:RUNDQGIRUWKHVDWLVIDFWLRQRIDOO REOLJDWLRQVLQFXUUHG 7RQQH±$OVRUHIHUUHGWRDV³PHWULFWRQ´5HSUHVHQWVDXQLWRIPHDVXUHLQWKH,QWHUQDWLRQDO 6\VWHPRI8QLWVHTXDOWRNLORJUDPV 8WLOLW\ ± 7UDFNV RYHUKHDG RU XQGHUJURXQG ZLUHV SLSHOLQHV FRQGXLWVGXFWV RU VWUXFWXUHV VHZHUVRUVWRUPGUDLQVRZQHGRSHUDWHGRUPDLQWDLQHGLQRUDFURVVDSXEOLFULJKWRIZD\RU HDVHPHQW :RUN ± 7KDW ZKLFK LV SURSRVHG WR EH FRQVWUXFWHG RU GRQH XQGHU WKH &RQWUDFW RU SHUPLW LQFOXGLQJWKHIXUQLVKLQJRIDOOODERUPDWHULDOVHTXLSPHQWDQGVHUYLFHV :RUNLQJ'UDZLQJV±'UDZLQJVVKRZLQJWKHGHWDLOVQRWVKRZQRQWKH3ODQVZKLFKDUHUHTXLUHG WREHGHVLJQHGE\WKH&RQWUDFWRU :RUNLQJ 1LJKW ± $ SHULRG RI QLJKWWLPH ZRUN DOORZHG RQO\ RQ 6XQGD\ WKURXJK7KXUVGD\ H[FOXGLQJKROLGD\V $%%5(9,$7,216 *HQHUDO7KHDEEUHYLDWLRQKHUHLQWRJHWKHUZLWKRWKHUVLQJHQHUDOXVHDUHDSSOLFDEOHWR WKHVH6WDQGDUG6SHFLILFDWLRQVDQGWRSURMHFW3ODQVRURWKHU&RQWUDFW'RFXPHQWV $OODEEUHYLDWLRQVDQGV\PEROVXVHGRQ3ODQVIRUVWUXFWXUDOVWHHOFRQVWUXFWLRQVKDOOFRQIRUPWR WKRVHJLYHQE\WKH³0DQXDORI6WHHO&RQVWUXFWLRQ´SXEOLVKHGE\WKH$PHULFDQ,QVWLWXWHRI6WHHO &RQVWUXFWLRQ,QF &RPPRQ8VDJH $EEUHYLDWLRQ:RUGRU:RUGV $EEUHYLDWLRQ:RUGRU:RUGV $%$1$EDQGRQ $%$1'$EDQGRQHG $%6$FU\ORQLWULOH±EXWDGLHQH±VW\UHQH $&$VSKDOW&RQFUHWH $&3$VEHVWRVFHPHQWSLSH $&:6$VSKDOWFRQFUHWHZHDULQJVXUIDFH $/7$OWHUQDWH $376$SDUWPHQWDQG$SDUWPHQWV $0(567'$PHULFDQ6WDQGDUG $:*$PHULFDQ:LUH*DJH QRQIHUURXVZLUH %&%HJLQQLQJRIFXUYH %&5%HJLQQLQJRIFXUEUHWXUQ %'5<%RXQGDU\ %)%RWWRPRIIRRWLQJ %/'*%XLOGLQJDQG%XLOGLQJV %0%HQFKPDUN %9&%HJLQQLQJRIYHUWLFDOFXUYH %:%DFNRIZDOO &&&HQWHUWRFHQWHU &$%&UXVKHGDJJUHJDWHEDVH &$/26+$&DOLIRUQLD2FFXSDWLRQDO6DIHW\DQG +HDOWK$GPLQLVWUDWLRQ &DO7UDQV&DOLIRUQLD'HSDUWPHQWRI7UDQVSRUWDWLRQ &$3&RUUXJDWHGDOXPLQXPSLSH &%&DWFK%DVLQ &E&XUE &%3&DWFK%DVLQ&RQQHFWLRQ3LSH &%5&DOLIRUQLD%HDULQJ5DWLR &&5&DOLIRUQLD&RGHRI5HJXODWLRQV &&79&ORVHG&LUFXLW79 &(6&DUOVEDG(QJLQHHULQJ6WDQGDUGV &)&XUEIDFH &)&XELFIRRW & *&XUEDQGJXWWHU &)5&RGHRI)HGHUDO5HJXODWLRQV &)6&XELF)HHWSHU6HFRQG &,3&DVWLURQSLSH &,33&DVWLQSODFHSLSH &/&OHDUDQFHFHQWHUOLQH &/)&KDLQOLQNIHQFH Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 5HYLVHG&RQWUDFW1R3DJHRI &0%&UXVKHGPLVFHOODQHRXVEDVH &0&&HPHQWPRUWDUFRDWHG &0/&HPHQWPRUWDUOLQHG &0:'&DUOVEDG0XQLFLSDO:DWHU'LVWULFW &2&OHDQRXW 6HZHU &2/&ROXPQ &200&RPPHUFLDO &21&&RQFUHWH &211&RQQHFWLRQ &2167&RQVWUXFW&RQVWUXFWLRQ &225'&RRUGLQDWH &63&RUUXJDWHGVWHHOSLSH &6'&DUOVEDG6WDQGDUG'UDZLQJV &7%&HPHQWWUHDWHGEDVH &9&KHFNYDOYH &<&XELF\DUG '/RDGRISLSH G%'HFLEHOV '%/'RXEOH ')'RXJODVILU ',$'LDPHWHU ',3'XFWLOHLURQSLSH '/'HDGORDG '5'LPHQVLRQ5DWLR '7'UDLQ7LOH ':*'UDZLQJ ':<'ULYHZD\ ':<$335'ULYHZD\DSSURDFK ((OHFWULF ($(DFK (&(QGRIFXUYH (&5(QGRIFXUEUHWXUQ ()(DFKIDFH (*(GJHRIJXWWHU (*/(QHUJ\JUDGHOLQH (,(OHYDWLRQ (/&(OHFWUROLHUOLJKWLQJFRQGXLW (/7([WUDORQJWRQ (1*5(QJLQHHU(QJLQHHULQJ (3(GJHRISDYHPHQW (607(DVHPHQW (7%(PXOVLRQWUHDWHGEDVH (9&(QGRIYHUWLFDOFXUE (:$(QFLQD:DVWHZDWHU$XWKRULW\ (;&([FDYDWLRQ (;3-7([SDQVLRQMRLQW (;67([LVWLQJ ))DKUHQKHLW ) &)UDPHDQGFRYHU ) ,)XUQLVKDQGLQVWDOO )$%)DEULFDWH )$6)ODVKLQJDUURZVLJQ )')ORRUGUDLQ )'1)RXQGDWLRQ )('63(&)HGHUDO6SHFLILFDWLRQ )*)LQLVKHGJUDGH )+)LUHK\GUDQW )/)ORZOLQH )6)LQLVKHGVXUIDFH )7/%)RRWSRXQG )7*)RRWLQJ ):)DFHRIZDOO **DV *$*DXJH *$/*DOORQDQG*DOORQV *$/9*DOYDQL]HG *$5*DUDJHDQG*DUDJHV *,3*DOYDQL]HGLURQSLSH */*URXQGOLQHRUJUDGHOLQH *0*DVPHWHU *19*URXQG1RW9LVLEOH *3*X\SROH *30JDOORQVSHUPLQXWH *5*UDGH *57**UDWLQJ *63*DOYDQL]HGVWHHOSLSH ++LJKRUKHLJKW +%+RVHELE +&+RXVHFRQQHFWLRQ +':/+HDGZDOO +*/+\GUDXOLFJUDGHOLQH +25,=+RUL]RQWDO +3+RUVHSRZHU +3*+LJKSUHVVXUHJDV +36+LJKSUHVVXUHVRGLXP /LJKW +<'5+\GUDXOLF ,(,QYHUW(OHYDWLRQ ,',QVLGHGLDPHWHU ,1&/,QFOXGLQJ,163,QVSHFWLRQ,19,QYHUW ,3,URQSLSH -&-XQFWLRQFKDPEHU -&7-XQFWLRQ -6-XQFWLRQVWUXFWXUH-7-RLQW//HQJWK /$%/DERUDWRU\ /$7/DWHUDO /%3RXQG/'/RFDOGHSUHVVLRQ/)/LQHDUIRRW /+/DPSKROH ///LYHORDG /2//D\RXWOLQH /21*/RQJLWXGLQDO/3/DPSSRVW/36/RZSUHVVXUHVRGLXP /LJKW /6/XPSVXP /76/LPHWUHDWHGVRLO /:'/HXFDGLD:DVWHZDWHU'LVWULFW 0$,170DLQWHQDQFH0$;0D[LPXP0&50LGGOHRIFXUEUHWXUQ 0($60HDVXUH 0+0DQKROHPDLQWHQDQFHKROH 0,/63(&0LOLWDU\VSHFLILFDWLRQ 0,6&0LVFHOODQHRXV02'0RGLILHGPRGLI\0210RQXPHQW 06/0HDQ6HD/HYHO 5HJ6WDQGDUG'UDZLQJ0 07%00LFURWXQQHOLQJ%RULQJ0DFKLQH 08/70XOWLSOH 087&'0DQXDORQ8QLIRUP7UDIILF&RQWURO'HYLFHV09/0HUFXU\YDSRUOLJKW1&7'1RUWK&RXQW\7UDQVLW'LVWULFW Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 5HYLVHG&RQWUDFW1R3DJHRI 15&31RQUHLQIRUFHGFRQFUHWHSLSH2%62EVROHWH 2&2QFHQWHU 2'2XWVLGHGLDPHWHU 2(2XWHUHGJH 2+(2YHUKHDG(OHFWULF20:'2OLYHQKDLQ0XQLFLSDO:DWHU'LVWULFW2332SSRVLWH 25,*2ULJLQDO 3%3XOOER[ 3&3RLQWRIFXUYDWXUH 3&&3RUWODQGFHPHQWFRQFUHWHRUSRLQWRIFRPSRXQGFXUYDWXUH 3&9&3RLQWRIFRPSRXQGYHUWLFDOFXUYH 3(3RO\HWK\OHQH 3,3RLQWRILQWHUVHFWLRQ 3/3URSHUW\OLQH 30%3URFHVVHGPLVFHOODQHRXVEDVH32&3RLQWRQFXUYH3273RLQWRQWDQJHQW 333RZHUSROH 35&3RLQWRIUHYHUVHFXUYH 359&3RLQWRIUHYHUVHYHUWLFDOFXUYH36,3RXQGVSHUVTXDUHLQFK373RLQWRIWDQJHQF\ 39&3RO\YLQ\OFKORULGH 39073DYHPHQW 3975:3ULYDWHULJKWRIZD\ 45DWHRIIORZLQFXELFIHHWSHUVHFRQG48$'4XDGUDQJOH4XDGUDQW55DGLXV 5 25RFNDQGRLO 5:5LJKWRIZD\ 5$5HF\FOLQJDJHQW 5$&5HF\FOHGDVSKDOWFRQFUHWH 5$35HFODLPHGDVSKDOWSDYHPHQW5%$&5XEEHUL]HGDVSKDOWFRQFUHWH 5&5HLQIRUFHGFRQFUHWH 5&%5HLQIRUFHGFRQFUHWHER[ 5&(5HJLVWHUHGFLYLOHQJLQHHU 5&35HLQIRUFHGFRQFUHWHSLSH5&95HPRWHFRQWUROYDOYH5()5HIHUHQFH 5(,1)5HLQIRUFHGRUUHLQIRUFHPHQW 5(65HVHUYRLU 5*(5HJLVWHUHGJHRWHFKQLFDOHQJLQHHU 52:5LJKWRI:D\555DLOURDG56(5HJLVWHUHGVWUXFWXUDOHQJLQHHU 57(5HJLVWHUHGWUDIILFHQJLQHHU 66HZHURU6ORSHDVDSSOLFDEOH 6&&36WHHOF\OLQGHUFRQFUHWHSLSH 6'6WRUPGUDLQ 6'156DQ'LHJR1RUWKHUQ5DLOZD\6'56WDQGDUGWKHUPRSODVWLFSLSHGLPHQVLRQUDWLR UDWLRRISLSH2'WRPLQLPXPZDOOWKLFNQHVV 6'56'6DQ'LHJR5HJLRQDO6WDQGDUG'UDZLQJV 6(6DQG(TXLYDOHQW 6(&6HFWLRQ 6)6TXDUHIRRW6)06HZHU)RUFH0DLQ6,,QWHUQDWLRQDO6\VWHPRI8QLWV 0HWULF 63(&6SHFLILFDWLRQV 633:&6WDQGDUG3ODQVIRU 3XEOLF:RUNV&RQVWUXFWLRQ 663:&6WDQGDUG6SHFLILFDWLRQVIRU3XEOLF:RUNV&RQVWUXFWLRQ 67+:<6WDWHKLJKZD\ 67$6WDWLRQ 67'6WDQGDUG 6756WUDLJKW675*56WUDLJKWJUDGH6758&6WUXFWXUDO6WUXFWXUH 6:6LGHZDON 6:'6LGHZDONGUDLQ 6<6TXDUH\DUG77HOHSKRQH7$17DQJHQW 7&7RSRIFXUE 7(/7HOHSKRQH 7)7RSRIIRRWLQJ 72327RSRJUDSK\ 757UDFW75$167UDQVLWLRQ767UDIILFVLJQDORUWUDQVLWLRQVWUXFWXUH 76&7UDIILFVLJQDOFRQGXLW 7667UDIILFVLJQDOVWDQGDUG 7:7RSRIZDOO7<37\SLFDO8(8QGHUJURXQG(OHFWULF 86$8QGHUJURXQG6HUYLFH$OHUW 9$59DULHV9DULDEOH 9%9DOYHER[ 9&9HUWLFDOFXUYH9&39LWULILHGFOD\SLSH9(579HUWLFDO 92/9ROXPH 9:'9DOOHFLWRV:DWHU'LVWULFW ::DWHU:LGHURU:LGWKDVDSSOLFDEOH :$7&+:RUN$UHD7UDIILF&RQWURO+DQGERRN:,:URXJKWLURQ:0:DWHUPHWHU :3-:HDNHQHGSODQHMRLQW ;&211&URVVFRQQHFWLRQ ;6(&&URVVVHFWLRQ Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 5HYLVHG&RQWUDFW1R$3DJHRI ,QVWLWXWLRQV $EEUHYLDWLRQ :RUGRU:RUGV $$6+72$PHULFDQ$VVRFLDWLRQRI6WDWH+LJKZD\DQG7UDQVSRUWDWLRQ2IILFLDOV $&,$PHULFDQ&RQFUHWH,QVWLWXWH $,6&$PHULFDQ,QVWLWXWHRI6WHHO&RQVWUXFWLRQ $16,$PHULFDQ1DWLRQDO6WDQGDUGV,QVWLWXWH $5($$PHULFDQ5DLOZD\(QJLQHHULQJ$VVRFLDWLRQ $60($PHULFDQ6RFLHW\RI0HFKDQLFDO(QJLQHHUV $64$PHULFDQ6RFLHW\IRU4XDOLW\ $670$PHULFDQ6RFLHW\IRU7HVWLQJDQG0DWHULDOV $:3$$PHULFDQ:RRG3UHVHUYHUV$VVRFLDWLRQ $:6$PHULFDQ:HOGLQJ6RFLHW\ $::$$PHULFDQ:DWHU:RUNV$VVRFLDWLRQ ((,(GLVRQ(OHFWULF,QVWLWXWH (,$(OHFWURQLF,QGXVWULHV$OOLDQFH (3$(QYLURQPHQWDO3URWHFWLRQ$JHQF\ (7/(OHFWULFDO7HVWLQJ/DERUDWRULHV )&&)HGHUDO&RPPXQLFDWLRQV&RPPLVVLRQ )+:$)HGHUDO+LJKZD\$GPLQLVWUDWLRQ *5,*HRV\QWKHWLF5HVHDUFK,QVWLWXWH ,(((,QVWLWXWHRI(OHFWULFDODQG(OHFWURQLFV(QJLQHHUV ,06$,QWHUQDWLRQDO0XQLFLSDO6LJQDO$VVRFLDWLRQ ,66$,QWHUQDWLRQDO6OXUU\6XUIDFLQJ$VVRFLDWLRQ ,7(,QVWLWXWHRI7UDQVSRUWDWLRQ(QJLQHHUV 1&+531DWLRQDO&RRSHUDWLYH+LJKZD\5HVHDUFK3URJUDP 1(0$1DWLRQDO(OHFWULFDO0DQXIDFWXUHUV$VVRFLDWLRQ 16)1DWLRQDO6FLHQFH)RXQGDWLRQ 26+$2FFXSDWLRQDO6DIHW\DQG+HDOWK$GPLQLVWUDWLRQ 33,3ODVWLFV3LSH,QVWLWXWH 5865XUDO8WLOLWLHV6HUYLFH 6$(6RFLHW\RI$XWRPRWLYH(QJLQHHUV 663&6RFLHW\IRU3URWHFWLYH&RDWLQJV 8/8QGHUZULWHUV /DERUDWRULHV,QF 81,762)0($685( *HQHUDO866WDQGDUG0HDVXUHVDOVRFDOOHG86&XVWRPDU\6\VWHPDUHWKHSULQFLSDO PHDVXUHPHQWV\VWHPLQWKHVHVSHFLILFDWLRQV+RZHYHUFHUWDLQPDWHULDOVSHFLILFDWLRQVDQGWHVW UHTXLUHPHQWV FRQWDLQHG KHUHLQ XVH 6, XQLWV VSHFLILFDOO\ DQG FRQYHUVLRQV WR 86 6WDQGDUG 0HDVXUHVPD\RUPD\QRWKDYHEHHQLQFOXGHGLQWKHVHFLUFXPVWDQFHV:KHQ866WDQGDUG 0HDVXUHVDUHQRWLQFOXGHGLQSDUHQWKHVLVWKHQWKH6,XQLWVVKDOOFRQWURO6,XQLWVDQG86 6WDQGDUG0HDVXUHVLQSDUHQWKHVLVPD\RUPD\QRWEHH[DFWO\HTXLYDOHQW 5HIHUHQFHLVDOVRPDGHWR$670(IRUGHILQLWLRQVRIYDULRXVXQLWVRIWKH6,V\VWHPDQGD PRUHH[WHQVLYHVHWRIFRQYHUVLRQIDFWRUV Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 5HYLVHG&RQWUDFW1R$3DJHRI 8QLWVRI0HDVXUHDQG7KHLU$EEUHYLDWLRQV 86&XVWRPDU\8QLW (TXDO7R 6,8QLW $EEUHYLDWLRQV $EEUHYLDWLRQV PLO LQ PLFURPHWHU PP LQFK LQ PLOOLPHWHU PP LQFK LQ FHQWLPHWHU FP IRRW IW PHWHU P \DUG \G PHWHU P PLOH PL NLORPHWHU NP VTXDUHIRRW IW VTXDUHPHWHU P VTXDUH\DUG \G VTXDUHPHWHU P FXELFIRRW IW FXELFPHWHU P FXELF\DUG \G FXELFPHWHU P DFUHKHFWDUH KD 86JDOORQ JDO /LWHU / IOXLGRXQFH IOR] PLOOLOHWHU P/ SRXQGPDVV OE DYRLUGXSRLV NLORJUDP NJ RXQFHPDVV R] NLORJUDP NJ 7RQ OEDYRLUGXSRLV 7RQQH NJ 3RLVHSDVFDO VHFRQG 3DV FHQWLVWRNH FV VTXDUHPLOOLPHWHUVSHU VHFRQG PP V SRXQGIRUFH OEI 1HZWRQ 1 SRXQGVSHUVTXDUHLQFK SVL .LORSDVFDO N3D SRXQGIRUFHSHUIRRW OEIIW 1HZWRQSHU PHWHU 1P IRRWSRXQGIRUFH IWOEI -RXOHV - IRRWSRXQGIRUFHSHUVHFRQG >IWOEI@V :DWW : SDUWSHUPLOOLRQ SSP PLOOLJUDPOLWHU PJ/ 7HPSHUDWXUH8QLWVDQG$EEUHYLDWLRQV 'HJUHH)DKUHQKHLW ) 'HJUHH&HOVLXV & ) [& & )± 6,8QLWV DEEUHYLDWLRQ &RPPRQO\8VHGLQ%RWK6\VWHPV $PSHUH $ 9ROW 9 &DQGHOD FG /XPHQ OP VHFRQG V &RPPRQ0HWULF3UHIL[HV NLOR N FHQWL F PLOOL P PLFUR P QDQR Q SLFR S 6<0%2/6 ' 'HOWDWKHFHQWUDODQJOHRUDQJOHEHWZHHQWDQJHQWV$QJOH 3HUFHQWµ)HHWRUPLQXWHV ³ ,QFKHVRUVHFRQGV SHURU EHWZHHQZRUGV 'HJUHH3/ 3URSHUW\OLQH&/&HQWHUOLQH6/ 6XUYH\OLQHRUVWDWLRQOLQH Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 5HYLVHG&RQWUDFW1R$3DJHRI 6(&7,21±6&23($1'&21752/2):25. $:$5'$1'(;(&87,212)&2175$&7$ZDUGDQGH[HFXWLRQRI&RQWUDFWZLOOEHDV SURYLGHGIRULQWKH6SHFLILFDWLRQV,QVWUXFWLRQWR%LGGHUVRU1RWLFH,QYLWLQJ%LGV $66,*10(171R&RQWUDFWRUSRUWLRQWKHUHRIPD\EHDVVLJQHGZLWKRXWFRQVHQWRIWKH ERDUG H[FHSWWKDW WKH FRQWUDFWRUPD\ DVVLJQ PRQH\ GXH RU ZKLFK ZLOO DFFUXH WR LW XQGHU WKH FRQWUDFW,IJLYHQZULWWHQQRWLFHVXFKDVVLJQPHQWZLOOEHUHFRJQL]HGE\WKH%RDUGWRWKHH[WHQW SHUPLWWHGE\ODZ$Q\DVVLJQPHQWRIPRQH\VKDOOEHVXEMHFWWRDOOSURSHUZLWKKROGLQJVLQIDYRURI WKH $JHQF\ DQG WR DOO GHGXFWLRQV SURYLGHG IRU LQ WKH &RQWUDFW$OO PRQH\ ZLWKKHOG ZKHWKHU DVVLJQHGRUQRWVKDOOEHVXEMHFWWREHLQJXVHGE\WKH$JHQF\IRUFRPSOHWLRQRIWKHZRUNVKRXOG WKH&RQWUDFWRUEHLQGHIDXOW 68%&2175$&76 *HQHUDO (DFK %LGGHU VKDOO FRPSO\ ZLWK WKH &KDSWHU RI WKH 3XEOLF &RQWUDFW &RGH LQFOXGLQJ6HFWLRQVWKURXJK7KHIROORZLQJH[FHUSWVRUVXPPDULHVRIVRPHRIWKH UHTXLUHPHQWVRIWKLV&KDSWHUDUHLQFOXGHGEHORZIRULQIRUPDWLRQ 7KH%LGGHUVKDOOVHWIRUWKLQWKH%LGDVSURYLGHGLQ ³ D 7KHQDPHDQGORFDWLRQRIWKHSODFHRIEXVLQHVVRIHDFKVXEFRQWUDFWRUZKR ZLOOSHUIRUPZRUNRUODERURUUHQGHUVHUYLFHWRWKHSULPHFRQWUDFWRULQRUDERXWWKH FRQVWUXFWLRQRIWKHZRUNRULPSURYHPHQWVRUDVXEFRQWUDFWRUOLFHQVHGE\WKH 6WDWH RI &DOLIRUQLD ZKR XQGHU VXEFRQWUDFW WR WKH SULPH FRQWUDFWRU VSHFLDOO\ IDEULFDWHVDQGLQVWDOOVDSRUWLRQRIWKHZRUNRULPSURYHPHQWDFFRUGLQJWRGHWDLOHG GUDZLQJVFRQWDLQHGLQWKHSODQVDQGVSHFLILFDWLRQVLQDQDPRXQWLQH[FHVVRI RQHKDOIRISHUFHQWRIWKHSULPHFRQWUDFWRU¶VWRWDOELGRULQWKHFDVHRIELGVRU RIIHUVIRUWKHFRQVWUXFWLRQRIVWUHHWVRUKLJKZD\VLQFOXGLQJEULGJHVLQH[FHVVRI RQHKDOIRISHUFHQWRIWKHSULPHFRQWUDFWRU¶VWRWDOELGRUWHQWKRXVDQGGROODUV ZKLFKHYHULVJUHDWHU´ ³ E 7KHSRUWLRQRIWKHZRUNZKLFKZLOOEHGRQHE\HDFKVXFKVXEFRQWUDFWRUXQGHU WKLV DFW 7KH SULPH FRQWUDFWRU VKDOO OLVW RQO\ RQH VXEFRQWUDFWRU IRU HDFK VXFK SRUWLRQDVLVGHILQHGE\WKHSULPHFRQWUDFWRULQKLVELG´ ,IWKH&RQWUDFWRUIDLOVWRVSHFLI\D6XEFRQWUDFWRURUVSHFLILHVPRUHWKDQRQH6XEFRQWUDFWRUIRU WKHVDPHSRUWLRQRIWKHZRUNWREHSHUIRUPHGXQGHUWKH&RQWUDFW LQH[FHVVRIRQHKDOIRI SHUFHQWRIWKH&RQWUDFWRU¶VWRWDO%LG WKH&RQWUDFWRUVKDOOEHTXDOLILHGWRSHUIRUPWKDWSRUWLRQ LWVHOIDQGVKDOOSHUIRUPWKDWSRUWLRQLWVHOIH[FHSWDVRWKHUZLVHSURYLGHGLQWKH&RGH $VSURYLGHGLQ6HFWLRQQR&RQWUDFWRUZKRVH%LGLVDFFHSWHGVKDOOVXEVWLWXWHDQ\SHUVRQ DV6XEFRQWUDFWRULQSODFHRIWKH6XEFRQWUDFWRUOLVWHGLQWKHRULJLQDO%LGH[FHSWIRUFDXVHVDQG E\SURFHGXUHVHVWDEOLVKHGLQ6HFWLRQ7KLVVHFWLRQSURYLGHVSURFHGXUHVWRFRUUHFWD FOHULFDOHUURULQWKHOLVWLQJRID6XEFRQWUDFWRU 6HFWLRQSURYLGHVWKDWD&RQWUDFWRUYLRODWLQJDQ\RIWKHSURYLVLRQVRIWKH&KDSWHUYLRODWHV WKH&RQWUDFWDQGWKH%RDUGPD\H[HUFLVHWKHRSWLRQHLWKHUWRFDQFHOWKH&RQWUDFWRUDVVHVVWKH &RQWUDFWRUDSHQDOW\LQDQDPRXQWRIQRWPRUHWKDQSHUFHQWRIWKHVXEFRQWUDFWLQYROYHGDIWHU DSXEOLFKHDULQJ Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 5HYLVHG&RQWUDFW1R$3DJHRI 6KRXOGWKH&RQWUDFWRUIDLOWRDGKHUHWRWKHSURYLVLRQVUHTXLULQJWKH&RQWUDFWRUWRFRPSOHWH SHUFHQWRIWKHFRQWUDFWSULFHZLWKLWVRZQRUJDQL]DWLRQWKH$JHQF\PD\DWLWVVROHGLVFUHWLRQ HOHFWWRFDQFHOWKHFRQWUDFWRUGHGXFWDQDPRXQWHTXDOWRSHUFHQWRIWKHYDOXHRIWKHZRUN SHUIRUPHGLQH[FHVVRISHUFHQWRIWKHFRQWUDFWSULFHE\RWKHUWKDQWKH&RQWUDFWRU¶VRZQ RUJDQL]DWLRQ 7KH %RDUG VKDOO EH WKH VROH ERG\ IRU GHWHUPLQDWLRQRIDYLRODWLRQRIWKHVH SURYLVLRQV,QDQ\SURFHHGLQJVXQGHUWKLVVHFWLRQWKHSULPHFRQWUDFWRUVKDOOEHHQWLWOHGWRD SXEOLFKHDULQJEHIRUHWKH%RDUGDQGVKDOOEHQRWLILHGWHQ GD\VLQDGYDQFHRIWKHWLPHDQG ORFDWLRQRIVDLGKHDULQJ7KHGHWHUPLQDWLRQRIWKH%RDUGVKDOOEHILQDO $GGLWLRQDO5HVSRQVLELOLW\7KH&RQWUDFWRUVKDOOJLYHSHUVRQDODWWHQWLRQWRWKHIXOILOOPHQW RIWKH&RQWUDFWDQGVKDOONHHSWKH:RUNXQGHULWVFRQWURO 7KH&RQWUDFWRUVKDOOSHUIRUPZLWKLWVRZQRUJDQL]DWLRQ&RQWUDFWZRUNDPRXQWLQJWRDWOHDVW SHUFHQWRIWKH&RQWUDFW3ULFHH[FHSWWKDWDQ\GHVLJQDWHG³6SHFLDOW\,WHPV´PD\EHSHUIRUPHGE\ VXEFRQWUDFWDQGWKHDPRXQWRIDQ\VXFK³6SHFLDOW\,WHPV´VRSHUIRUPHGPD\EHGHGXFWHGIURP WKH&RQWUDFW3ULFHEHIRUHFRPSXWLQJWKHDPRXQWUHTXLUHGWREHSHUIRUPHGE\WKH&RQWUDFWRU ZLWK LWV RZQ RUJDQL]DWLRQ ³6SHFLDOW\ ,WHPV´ ZLOO EH LGHQWLILHGE\WKH$JHQF\LQWKH%LGRU 3URSRVDO:KHUHDQHQWLUHLWHPLVVXEFRQWUDFWHGWKHYDOXHRIZRUNVXEFRQWUDFWHGZLOOEHEDVHG RQ WKH &RQWUDFW 8QLW 3ULFH :KHQ D SRUWLRQ RI DQ LWHP LV VXEFRQWUDFWHG WKH YDOXH RI ZRUN VXEFRQWUDFWHGZLOOEHEDVHGRQWKHHVWLPDWHGSHUFHQWDJHRIWKH&RQWUDFW8QLW3ULFH7KLVZLOOEH GHWHUPLQHG IURP LQIRUPDWLRQ VXEPLWWHG E\ WKH &RQWUDFWRU DQG VXEMHFW WR DSSURYDO E\ WKH (QJLQHHU %HIRUHWKHZRUNRIDQ\6XEFRQWUDFWRULVVWDUWHGWKH&RQWUDFWRUVKDOOVXEPLWWRWKH(QJLQHHUIRU DSSURYDO D ZULWWHQ VWDWHPHQW VKRZLQJ WKH ZRUN WR EH VXEFRQWUDFWHG JLYLQJ WKH QDPH DQG EXVLQHVVRIHDFK6XEFRQWUDFWRUDQGGHVFULSWLRQDQGYDOXHRIHDFKSRUWLRQRIWKHZRUNWREHVR VXEFRQWUDFWHG 6WDWXV RI 6XEFRQWUDFWRUV 6XEFRQWUDFWRUV VKDOO EH FRQVLGHUHG HPSOR\HHV RI WKH &RQWUDFWRUDQGWKH&RQWUDFWRUVKDOOEHUHVSRQVLEOHIRUWKHLUZRUN &2175$&7%21'6%HIRUHH[HFXWLRQRIWKH&RQWUDFWWKH%LGGHUVKDOOILOHVXUHW\ERQGV ZLWKWKH$JHQF\WREHDSSURYHGE\WKH%RDUGLQWKHDPRXQWVDQGIRUWKHSXUSRVHVQRWHGEHORZ %RQGVLVVXHGE\DVXUHW\ZKRLVDXWKRUL]HGWRLVVXHERQGVLQ&DOLIRUQLDDQGZKRVHERQGLQJ OLPLWDWLRQ VKRZQ LQ VDLG FLUFXODU LV VXIILFLHQW WR SURYLGH ERQGV LQ WKH DPRXQW UHTXLUHG E\ WKH &RQWUDFWVKDOOEHGHHPHGWREHDSSURYHGXQOHVVVSHFLILFDOO\UHMHFWHGE\WKH$JHQF\%RQGVIURP DOO RWKHU VXUHWLHV VKDOO EH DFFRPSDQLHG E\ DOO RI WKH GRFXPHQWV HQXPHUDWHG LQ &RGH RI &LYLO 3URFHGXUH D 7KH%LGGHUVKDOOSD\DOOERQGSUHPLXPVFRVWVDQGLQFLGHQWDOV %HIRUH H[HFXWLRQ RI WKH &RQWUDFW WKH %LGGHU VKDOO ILOH VXUHW\ERQGV ZLWK WKH $JHQF\ WR EH DSSURYHGE\WKH%RDUGLQWKHDPRXQWVDQGIRUWKHSXUSRVHVQRWHGEHORZ%RQGVLVVXHGE\D VXUHW\ZKRLVDXWKRUL]HGWRLVVXHERQGVLQ&DOLIRUQLDDQGZKRVHERQGLQJOLPLWDWLRQVKRZQLQ VDLG FLUFXODU LV VXIILFLHQW WR SURYLGH ERQGV LQ WKH DPRXQW UHTXLUHG E\ WKH &RQWUDFW VKDOO EH GHHPHG WR EH DSSURYHG XQOHVV VSHFLILFDOO\ UHMHFWHG E\ WKH $JHQF\ %RQGV IURP DOO RWKHU VXUHWLHVVKDOOEHDFFRPSDQLHGE\DOORIWKHGRFXPHQWVHQXPHUDWHGLQ&RGHRI&LYLO3URFHGXUH D 7KH%LGGHUVKDOOSD\DOOERQGSUHPLXPVFRVWVDQGLQFLGHQWDOV (DFKERQGVKDOOLQFRUSRUDWHE\UHIHUHQFHWKH&RQWUDFWDQGEHVLJQHGE\ERWKWKH%LGGHUDQG 6XUHW\DQGWKHVLJQDWXUHRIWKHDXWKRUL]HGDJHQWRIWKH6XUHW\VKDOOEHQRWDUL]HG Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 5HYLVHG&RQWUDFW1R$3DJHRI 7KH&RQWUDFWRUVKDOOSURYLGHDIDLWKIXOSHUIRUPDQFHZDUUDQW\ERQGDQGSD\PHQWERQG ODERUDQG PDWHULDOVERQG IRUWKLVFRQWUDFW7KHIDLWKIXOSHUIRUPDQFHZDUUDQW\ERQGVKDOOEHLQDVXPQRW OHVVWKDQRQHKXQGUHGSHUFHQWRIWKHWRWDODPRXQWSD\DEOHE\WKHWHUPVRIWKLVFRQWUDFW7KH &RQWUDFWRUVKDOOSURYLGHERQGVWRVHFXUHSD\PHQWRIODERUHUVDQGPDWHULDOVVXSSOLHUVLQDVXP QRWOHVVWKDQRQHKXQGUHGSHUFHQWRIWKHWRWDODPRXQWSD\DEOHE\WKHWHUPVRIWKLVFRQWUDFW %RWKERQGVVKDOOH[WHQGLQIXOOIRUFHDQGHIIHFWDQGEHUHWDLQHGE\WKH$JHQF\GXULQJWKLVSURMHFW XQWLOWKH\DUHUHOHDVHGDFFRUGLQJWRWKHSURYLVLRQVRIWKLVVHFWLRQ 7KHIDLWKIXOSHUIRUPDQFHZDUUDQW\ERQGZLOOEHUHGXFHGWRSHUFHQWRIWKHRULJLQDODPRXQW GD\VDIWHUUHFRUGDWLRQRIWKH1RWLFHRI&RPSOHWLRQDQGZLOOUHPDLQLQIXOOIRUFHDQGHIIHFWIRUWKH RQH\HDUZDUUDQW\SHULRGDQGXQWLODOOZDUUDQW\UHSDLUVDUHFRPSOHWHGWRWKHVDWLVIDFWLRQRIWKH (QJLQHHU7KHERQGVWRVHFXUHSD\PHQWRIODERUHUVDQGPDWHULDOVVXSSOLHUVVKDOOEHUHOHDVHG VL[PRQWKVSOXVGD\VDIWHUUHFRUGDWLRQRIWKH1RWLFHRI&RPSOHWLRQLIDOOFODLPVKDYHEHHQ SDLG $OOERQGVDUHWREHSODFHGZLWKDVXUHW\LQVXUDQFHFDUULHUDGPLWWHGDQGDXWKRUL]HGWRWUDQVDFW WKHEXVLQHVVRILQVXUDQFHLQ&DOLIRUQLDDQGZKRVHDVVHWVH[FHHGWKHLUOLDELOLWLHVLQDQDPRXQW HTXDO WR RU LQ H[FHVV RI WKH DPRXQW RI WKH ERQG 7KH ERQGV DUHWR FRQWDLQ WKH IROORZLQJ GRFXPHQWV $QRULJLQDORUDFHUWLILHGFRS\RIWKHXQUHYRNHGDSSRLQWPHQWSRZHURIDWWRUQH\E\ODZV RURWKHULQVWUXPHQWHQWLWOLQJRUDXWKRUL]LQJWKHSHUVRQZKRH[HFXWHGWKHERQGWRGRVR $ FHUWLILHG FRS\ RI WKH FHUWLILFDWH RI DXWKRULW\ RI WKH LQVXUHU LVVXHG E\ WKH LQVXUDQFH FRPPLVVLRQHU ,IWKHELGLVDFFHSWHGWKH$JHQF\PD\UHTXLUHDILQDQFLDOVWDWHPHQWRIWKHDVVHWVDQGOLDELOLWLHV RIWKHLQVXUHUDWWKHHQGRIWKHTXDUWHUFDOHQGDU\HDUSULRUWRGD\VQH[WSUHFHGLQJWKHGDWHRI WKHH[HFXWLRQRIWKHERQG7KHILQDQFLDOVWDWHPHQWVKDOOEHPDGHE\DQRIILFHU VFHUWLILFDWHDV GHILQHGLQ6HFWLRQRIWKH&RUSRUDWLRQV&RGH,QWKHFDVHRIDIRUHLJQLQVXUHUWKHILQDQFLDO VWDWHPHQWPD\EHYHULILHGE\WKHRDWKRIWKHSULQFLSDORIILFHURUPDQDJHUUHVLGLQJZLWKLQWKH 8QLWHG6WDWHV 6KRXOGDQ\ERQGEHFRPHLQVXIILFLHQWWKH&RQWUDFWRUVKDOOUHQHZWKHERQGZLWKLQGD\VDIWHU UHFHLYLQJQRWLFHIURPWKH$JHQF\ 6KRXOGDQ\6XUHW\DWDQ\WLPHEHXQVDWLVIDFWRU\WRWKH%RDUGQRWLFHZLOOEHJLYHQWKH&RQWUDFWRU WRWKDWHIIHFW1RIXUWKHUSD\PHQWVVKDOOEHGHHPHGGXHRUZLOOEHPDGHXQGHUWKHFRQWUDFWXQWLO DQHZ6XUHW\VKDOOTXDOLI\DQGEHDFFHSWHGE\WKH%RDUG &KDQJHVLQWKH:RUNRUH[WHQVLRQVRIWLPHPDGHSXUVXDQWWRWKH&RQWUDFWVKDOOLQQRZD\ UHOHDVHWKH&RQWUDFWRURU6XUHW\IURPLWVREOLJDWLRQV1RWLFHRIVXFKFKDQJHVRUH[WHQVLRQVVKDOO EHZDLYHGE\WKH6XUHW\ 3/$16$1'63(&,),&$7,216 *HQHUDO7KH&RQWUDFWRUVKDOONHHSDWWKH:RUNVLWHDFRS\RIWKHFRQWUDFWGRFXPHQWV DQGVSHFLILFDWLRQVWRZKLFKWKH(QJLQHHUVKDOOKDYHDFFHVVDWDOOWLPHV 7KHVSHFLILFDWLRQVIRUWKHZRUNLQFOXGHWKH*HQHUDO3URYLVLRQV3URMHFW7HFKQLFDO6SHFLILFDWLRQV &DUOVEDG(QJLQHHULQJ6WDQGDUGV &(6 6WDQGDUG6SHFLILFDWLRQVIRU3XEOLF:RUNV&RQVWUXFWLRQ Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 5HYLVHG&RQWUDFW1R$3DJHRI 663:& DQGWKHODWHVWVXSSOHPHQWVWKHUHWRHGLWLRQDVSXEOLVKHGE\WKH*UHHQERRN &RPPLWWHHRI3XEOLF:RUNV6WDQGDUGV,QFKHUHLQDIWHUGHVLJQDWHG663:&DVDPHQGHG 7KH6WDQGDUG'UDZLQJVFRQVLVWRIWKHODWHVWHGLWLRQRIWKH6DQ'LHJR$UHD5HJLRQDO6WDQGDUG 'UDZLQJVKHUHLQDIWHUGHVLJQDWHG6'56'DVLVVXHGE\WKH6DQ'LHJR&RXQW\'HSDUWPHQWRI 3XEOLF :RUNV WRJHWKHU ZLWK WKH PRVW UHFHQW HGLWLRQV RI WKH &LW\ RI &DUOVEDG (QJLQHHULQJ 6WDQGDUGV DQG &DUOVEDG 6WDQGDUG 'UDZLQJV DV LVVXHG E\ WKH &LW\ RI &DUOVEDG DQG WKH &DUOVEDG 0XQLFLSDO :DWHU 'LVWULFW KHUHLQDIWHU GHVLJQDWHG DV &(6 DQG &6' UHVSHFWLYHO\ 0RGLILHGVWDQGDUGGUDZLQJVLIDSSOLFDEOH DUH HQFORVHGLQWKHDSSHQGLFHVWRWKHVH*HQHUDO 3URYLVLRQV 7KH 6SHFLILFDWLRQV DQG RWKHU &RQWUDFW 'RFXPHQWV VKDOO JRYHUQ WKH :RUN 7KH &RQWUDFW 'RFXPHQWVDUHLQWHQGHGWREHFRPSOHPHQWDU\DQGFRRSHUDWLYH 7KH&RQWUDFWRUVKDOODVFHUWDLQWKHH[LVWHQFHRIDQ\FRQGLWLRQVDIIHFWLQJWKHFRVWRIWKH:RUN WKURXJKDUHDVRQDEOHH[DPLQDWLRQRIWKH:RUNVLWHSULRUWRVXEPLWWLQJWKH%LG ([LVWLQJLPSURYHPHQWVYLVLEOHDWWKH:RUNVLWHIRUZKLFKQRVSHFLILFGLVSRVLWLRQLVPDGHLQWKH FRQWUDFWGRFXPHQWVEXWZKLFKLQWHUIHUHZLWKWKHFRPSOHWLRQRIWKH:RUNVKDOOEHUHPRYHGDQG GLVSRVHGRIE\WKH&RQWUDFWRU 7KH &RQWUDFWRU VKDOO XSRQ GLVFRYHULQJ DQ\ HUURU RU RPLVVLRQ LQ WKH FRQWUDFW GRFXPHQWV RU 6SHFLILFDWLRQVLPPHGLDWHO\FDOOLWWRWKHDWWHQWLRQRIWKH(QJLQHHU 3UHFHGHQFHRI&RQWUDFW'RFXPHQWV ,I WKHUH LV D FRQIOLFW LQ WKH &RQWUDFW 'RFXPHQWV WKH GRFXPHQWKLJKHVW LQ SUHFHGHQFH VKDOO FRQWURO7KHSUHFHGHQFHVKDOOEHWKHPRVWUHFHQWHGLWLRQRIWKHIROORZLQJGRFXPHQWVOLVWHGLQ RUGHURIKLJKHVWWRORZHVWSUHFHGHQFH 3HUPLWVIURPRWKHUDJHQFLHVDVPD\EHUHTXLUHGE\ODZ &KDQJHRUGHUVZKLFKHYHURFFXUVODVW &RQWUDFWDGGHQGDZKLFKHYHURFFXUVODVW &RQWUDFW 7HFKQLFDO6SHFLILFDWLRQV &DUOVEDG*HQHUDODQG6XSSOHPHQWDO3URYLVLRQV &DUOVEDG(QJLQHHULQJ6WDQGDUGV 7HFKQLFDO6SHFLILFDWLRQV 6WDQGDUGV3ODQV D &LW\RI&DUOVEDG6WDQGDUG'UDZLQJV E &LW\RI&DUOVEDG6WDQGDUG'UDZLQJV F &LW\RI&DUOVEDGPRGLILFDWLRQVWRWKH6DQ'LHJR$UHD5HJLRQDO6WDQGDUG'UDZLQJV G 6DQ'LHJR$UHD5HJLRQDO6WDQGDUG'UDZLQJV H 7UDIILF6LJQDO'HVLJQ*XLGHOLQHVDQG6WDQGDUGV I 6WDWHRI&DOLIRUQLD'HSDUWPHQWRI7UDQVSRUWDWLRQ6WDQGDUG3ODQV J 6WDWHRI&DOLIRUQLD'HSDUWPHQWRI7UDQVSRUWDWLRQ6WDQGDUG6SHFLILFDWLRQV K &DOLIRUQLD0DQXDORQ8QLIRUP7UDIILF&RQWURO'HYLFHV &$087&' 6WDQGDUG6SHFLILFDWLRQVIRU3XEOLF:RUNV&RQVWUXFWLRQDVDPHQGHG 5HIHUHQFH6SHFLILFDWLRQV 0DQXIDFWXUHU¶V,QVWDOODWLRQ5HFRPPHQGDWLRQV Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 5HYLVHG&RQWUDFW1R$3DJHRI 'HWDLOGUDZLQJVVKDOOWDNHSUHFHGHQFHRYHUJHQHUDOGUDZLQJV 'HWDLOHGSODQVDQGSODQYLHZVVKDOOKDYHSUHFHGHQFHRYHUJHQHUDOSODQV 3UHFHGHQFH RI&DOWUDQV6SHFLILFDWLRQV:KHUH &DOWUDQV VSHFLILFDWLRQVDUH XVHG WR PRGLI\ WKH 663:& RU DUH DGGHG WRWKH 663:& E\ WKH &RQWUDFW 'RFXPHQWVWKH &DOWUDQV VSHFLILFDWLRQV VKDOO KDYH SUHFHGHQFH RQO\ LQ UHIHUHQFH WR WKH PDWHULDOV UHIHUUHG WR LQ WKH &DOWUDQV VSHFLILFDWLRQV 7KH GRFXPHQWV OLVWHG LQ 6HFWLRQ DERYH LQ WKHLU RUGHU RI SUHFHGHQFHDERYHVKDOOSUHYDLORYHUWKH&DOWUDQVVSHFLILFDWLRQVLQDOORWKHUPDWWHUV 6XEPLWWDOV *HQHUDO 6XEPLWWDOV VKDOO EH SURYLGHG DW WKH &RQWUDFWRU¶V H[SHQVH DVUHTXLUHG LQ DQG ZKHQ UHTXLUHG E\ WKH 3ODQV RU 6SHFLDO 3URYLVLRQV RU ZKHQ UHTXHVWHGE\WKH(QJLQHHU 2QHHOHFWURQLF 3') ILOHVKDOOEHVXEPLWWHG,IUHYLVLRQVDUHUHTXLUHGWKH(QJLQHHUZLOOUHWXUQ RQHUHGOLQHGFRS\IRUUHVXEPLVVLRQ8SRQDFFHSWDQFHWKH(QJLQHHUZLOOUHWXUQRQHHOHFWURQLF FRS\WRWKH&RQWUDFWRU 0DWHULDOVVKDOOQHLWKHUEHIXUQLVKHGQRUIDEULFDWHGQRUVKDOODQ\ZRUNIRUZKLFKVXEPLWWDOVDUH UHTXLUHGEHSHUIRUPHGEHIRUHWKHUHTXLUHGVXEPLWWDOVKDYHEHHQUHYLHZHGDQGDFFHSWHGE\WKH (QJLQHHU 1HLWKHU UHYLHZ QRU DFFHSWDQFH RI VXEPLWWDOV E\ WKH (QJLQHHU VKDOO UHOLHYH WKH &RQWUDFWRUIURPUHVSRQVLELOLW\IRUHUURUVRPLVVLRQVRUGHYLDWLRQVIURPWKH&RQWUDFW'RFXPHQWV XQOHVVVXFKGHYLDWLRQVZHUHVSHFLILFDOO\FDOOHGWRWKHDWWHQWLRQRIWKH(QJLQHHULQWKHOHWWHURI WUDQVPLWWDO7KH&RQWUDFWRUVKDOOEHUHVSRQVLEOHIRUWKHFRUUHFWQHVVRIWKHVXEPLWWDOV 7KH &RQWUDFWRU VKDOO DOORZ D PLQLPXP RI ZRUNLQJ GD\V IRU UHYLHZ RI VXEPLWWDOV XQOHVV RWKHUZLVHVSHFLILHGLQWKH6SHFLDO3URYLVLRQV(DFKVXEPLWWDOVKDOOEHDFFRPSDQLHGE\DOHWWHURI WUDQVPLWWDO (DFKVXEPLWWDOVKDOOEHFRQVHFXWLYHO\QXPEHUHG5HVXEPLWWDOVVKDOOEHODEHOHGZLWKWKHQXPEHU RIWKHRULJLQDOVXEPLWWDOIROORZHGE\DQDVFHQGLQJDOSKDEHWLFDOGHVLJQDWLRQ HJ7KHODEHOµ&¶ ZRXOGLQGLFDWHWKHWKLUGLQVWDQFHWKDWWKHIRXUWKVXEPLWWDOKDGEHHQJLYHQWRWKH(QJLQHHU (DFK VKHHW RI HDFK VXEPLWWDO VKDOO EH FRQVHFXWLYHO\ QXPEHUHG (DFK VHW RI VKRS GUDZLQJV DQG VXEPLWWDOVVKDOOEHDFFRPSDQLHGE\DOHWWHURIWUDQVPLWWDORQWKH&RQWUDFWRU¶VOHWWHUKHDG7KH OHWWHURIWUDQVPLWWDOVKDOOFRQWDLQWKHIROORZLQJ 3URMHFWWLWOHDQG$JHQF\FRQWUDFWQXPEHU 1XPEHURIFRPSOHWHVHWV &RQWUDFWRU¶VFHUWLILFDWLRQVWDWHPHQW 6SHFLILFDWLRQVHFWLRQQXPEHU V SHUWDLQLQJWRPDWHULDOVXEPLWWHGIRUUHYLHZ 6XEPLWWDO QXPEHU 6XEPLWWDO QXPEHUV VKDOO EH FRQVHFXWLYH LQFOXGLQJ VXEVHTXHQW VXEPLWWDOVIRUWKHVDPHPDWHULDOV 'HVFULSWLRQRIWKHFRQWHQWVRIWKHVXEPLWWDO ,GHQWLILFDWLRQRIGHYLDWLRQVIURPWKH&RQWUDFW'RFXPHQWV 7KHVLJQDWXUHSULQWHGQDPHWLWOHDQGFRPSDQ\QDPHRIWKH&RQWUDFWRU¶VUHSUHVHQWDWLYH 7KH&RQWUDFWRUVKDOOVXEVFULEHWRDQGVKDOOSODFHWKHIROORZLQJFHUWLILFDWLRQRQDOOVXEPLWWDOV Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 5HYLVHG&RQWUDFW1R$3DJH RI ³, KHUHE\ FHUWLI\ WKDW WKH HTXLSPHQW PDWHULDO SURFHGXUH V VKRZQDQG PDUNHGLQWKLVVXEPLWWDOLVWKDWSURSRVHGWREHLQFRUSRUDWHGLQWRWKLV3URMHFW LV LQ FRPSOLDQFH ZLWK WKH &RQWUDFW 'RFXPHQWV FDQ EH LQVWDOOHGLQ WKH DOORFDWHGVSDFHVDQGLVVXEPLWWHGIRUDSSURYDO´ 2U ³ ,KHUHE\FHUWLI\WKDWWKH HTXLSPHQWPDWHULDOSURFHGXUH V FRQWDLQHGKHUHLQ PHHWDOOUHTXLUHPHQWVVKRZQRUVSHFLILHGLQWKH&RQWUDFW'RFXPHQWVH[FHSW IRUWKHIROORZLQJGHYLDWLRQ V ´ :RUNLQJ'UDZLQJV:RUNLQJGUDZLQJVDUHGUDZLQJVVKRZLQJGHWDLOVQRWVKRZQRQWKH 3ODQVZKLFKDUHUHTXLUHGWREHGHVLJQHGE\WKH&RQWUDFWRU:RUNLQJGUDZLQJVVKDOOEHRIDVL]H DQGVFDOHWRFOHDUO\VKRZDOOQHFHVVDU\GHWDLOV :RUNLQJGUDZLQJVDUHUHTXLUHGLQWKHIROORZLQJVHFWLRQV 7$%/( ,WHP6HFWLRQ1XPEHU7LWOH6XEMHFW 'HZDWHULQJ([FDYDWLRQ'HZDWHULQJ 6DIHW\2UGHUV7UHQFK6KRULQJ 6WHHO3ODWH&RYHUV6WHHO3ODWH%ULGJLQJ &RIIHUGDPV6WUXFWXUH([FDYDWLRQ %DFNILOO 6:3336:333 *HQHUDO)DOVHZRUN *HQHUDO3ODFLQJ5HLQIRUFHPHQW *HQHUDO3UHVWUHVVHG&RQFUHWH&RQVWUXFWLRQ )DOVHZRUN3ODQV6WUXFWXUDO6WHHO *HQHUDO-DFNLQJ2SHUDWLRQV *HQHUDO7XQQHOLQJ2SHUDWLRQV 0LFURWXQQHOLQJ0LFURWXQQHOLQJ2SHUDWLRQV 7HPSRUDU\7UDIILF&RQWURO3ODQ7UDIILF&RQWURO 7HPSRUDU\6HZHU%\SDVV3XPSLQJ6HZHU%\SDVVLQJ :RUNLQJGUDZLQJVOLVWHGDERYHDV,WHPV DQGVKDOOEHSUHSDUHGE\ D&LYLORU6WUXFWXUDO(QJLQHHUUHJLVWHUHGE\WKH6WDWHRI&DOLIRUQLD 6KRS 'UDZLQJV 6KRS GUDZLQJV DUH GUDZLQJV VKRZLQJ GHWDLOV RI PDQXIDFWXUHG RU DVVHPEOHGSURGXFWVSURSRVHGWREHLQFRUSRUDWHGLQWRWKH:RUN6KRSGUDZLQJVDUHUHTXLUHGLQ WKHIROORZLQJVHFWLRQVDQGDVVSHFLILHGLQWKH6SHFLDO3URYLVLRQV 7$%/( ,WHP6HFWLRQ1XPEHU7LWOH6XEMHFW -RLQWV5HLQIRUFHG&RQFUHWH3LSH -RLQWV9LWULILHG&OD\3LSH 6KRS'UDZLQJV6WUXFWXUDO6WHHO *HQHUDO0HWDO+DQG5DLOLQJV 6XSSRUWLQJ ,QIRUPDWLRQ 6XSSRUWLQJ LQIRUPDWLRQ LV LQIRUPDWLRQ UHTXLUHG E\ WKH 6SHFLILFDWLRQV IRU WKH SXUSRVHV RI DGPLQLVWUDWLRQ RI WKH &RQWUDFW DQDO\VLV IRU YHULILFDWLRQ RI Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 5HYLVHG&RQWUDFW1R$3DJHRI FRQIRUPDQFHZLWKWKH6SHFLILFDWLRQVWKHRSHUDWLRQDQGPDLQWHQDQFHRIDPDQXIDFWXUHGSURGXFW RUV\VWHPWREHFRQVWUXFWHGDVSDUWRIWKH:RUNDQGRWKHULQIRUPDWLRQDVPD\EHUHTXLUHGE\ WKH(QJLQHHU7KUHHKDUGFRSLHVDQGRQHHOHFWURQLF 3') ILOHRIWKHVXSSRUWLQJLQIRUPDWLRQVKDOO EHVXEPLWWHGWRWKH(QJLQHHUSULRUWRWKHVWDUWRIWKH:RUNXQOHVVRWKHUZLVHVSHFLILHGLQWKH 6SHFLDO 3URYLVLRQV RU GLUHFWHG E\WKH (QJLQHHU 6XSSRUWLQJ LQIRUPDWLRQIRUV\VWHPVVKDOOEH ERXQGWRJHWKHUDQGLQFOXGHDOOPDQXIDFWXUHGLWHPVIRUWKHV\VWHP,IUHVXEPLWWDOLVQRWUHTXLUHG RQHUHGOLQHGFRS\ZLOOEHUHWXUQHGWRWKH&RQWUDFWRU6XSSRUWLQJLQIRUPDWLRQVKDOOFRQVLVWRIWKH IROORZLQJDQGLVUHTXLUHGXQOHVVRWKHUZLVHVSHFLILHGLQWKH6SHFLDO3URYLVLRQV /LVWRI6XEFRQWUDFWRUVSHU /LVWRI0DWHULDOVSHU &HUWLILFDWLRQVSHU &RQVWUXFWLRQ6FKHGXOHSHUDQG:RUN3ODQSHU &RQILQHG6SDFH(QWU\3URJUDPSHU &RQFUHWHPL[GHVLJQVSHU $VSKDOWFRQFUHWHPL[GHVLJQVSHU &RQWUROOHU&DELQHW:LULQJ'LDJUDPVSHU 'DWDLQFOXGLQJEXWQRWOLPLWHGWRFDWDORJVKHHWVPDQXIDFWXUHU¶VEURFKXUHVWHFKQLFDO EXOOHWLQVVSHFLILFDWLRQVGLDJUDPVSURGXFWVDPSOHVDQGRWKHULQIRUPDWLRQQHFHVVDU\WR GHVFULEHDV\VWHPSURGXFWRULWHP7KLVLQIRUPDWLRQLVUHTXLUHGIRULUULJDWLRQV\VWHPV VWUHHWOLJKWLQJV\VWHPVDQGWUDIILFVLJQDOVDQGPD\DOVREHUHTXLUHGIRUDQ\SURGXFW PDQXIDFWXUHGLWHPRUV\VWHP 7HPSRUDU\KLJKOLQHSODQSHU&DUOVEDG(QJLQHHULQJ6WDQGDUGV 5HFRUG'UDZLQJV 7KH&RQWUDFWRU VKDOOPDLQWDLQDFRPSOHWH DVEXLOWUHFRUGVHWRI EOXHOLQH SULQWV ZKLFK VKDOO EH FRUUHFWHG LQ UHG LQN GDLO\ DQG VKRZ HYHU\ FKDQJH IURP WKH RULJLQDO GUDZLQJV DQG VSHFLILFDWLRQV DQG WKH H[DFW DVEXLOW ORFDWLRQV VL]HV DQG NLQGV RI HTXLSPHQWXQGHUJURXQGSLSLQJFRQGXLWVYDOYHVDQGDOORWKHUZRUNQRWYLVLEOHDWVXUIDFHJUDGH 3ULQWVIRUWKLVSXUSRVHPD\EHREWDLQHGIURPWKH$JHQF\DWFRVW7KHRIILFLDOUHFRUGGUDZLQJ VKDOODFFXUDWHO\UHIOHFWDOOFKDQJHVDQGPRGLILFDWLRQVWRWKHRULJLQDOSODQ7KH&RQWUDFWRUVKDOO IRUPDOO\VXEPLWWKHILQDOUHFRUGGUDZLQJDWWKHILQDOZDONWKURXJKPHHWLQJ$WWKHGLUHFWLRQRIWKH (QJLQHHUWKH&RQWUDFWRUVKDOOFRUUHFWDQGUHYLVHWKH5HFRUG'UDZLQJVWRDFFXUDWHO\UHIOHFWILHOG FRQGLWLRQV5HVXEPLWWDORIWKH5HFRUG'UDZLQJVVKDOOEHFRPSOHWHGZLWKLQWHQ ZRUNLQJ GD\VRIWKHILQDOZDONWKURXJKPHHWLQJGDWHDQGVKDOOUHIOHFWDQ\DGGLWLRQDOSXQFKOLVWLWHPV 3D\PHQWIRUWKHXSNHHSUHYLVLRQDQGVXEPLWWDORIWKHUHFRUGGUDZLQJVVKDOOEHLQFOXGHGLQWKH OXPSVXPSULFHIRUPRELOL]DWLRQ 3URMHFW0DQDJHPHQWDQG'RFXPHQW&RQWURO7KH&RQWUDFWRUVKDOOXWLOL]HWKH$JHQF\¶V VWDQGDUGL]HG RQOLQH SURMHFW PDQDJHPHQW DQG GRFXPHQW FRQWURO SODWIRUP 3URFRUH ZZZSURFRUHFRP 7KH&RQWUDFWRULVUHTXLUHGWRFUHDWHDIUHHZHEEDVHGXVHUDFFRXQW V DQGXWLOL]HZHEEDVHGWUDLQLQJWXWRULDOV DVQHHGHG WREHFRPHIDPLOLDUZLWKWKHV\VWHP8QOHVV WKH(QJLQHHUDSSURYHVRWKHUZLVHWKH&RQWUDFWRUVKDOOSURFHVVDOOSURMHFWGRFXPHQWVWKURXJK 3URFRUH,IXQIDPLOLDURUQRWRWKHUZLVHWUDLQHGZLWK3URFRUHWKH&RQWUDFWRUDQGDSSOLFDEOHWHDP PHPEHUV VKDOO FRPSOHWH D IUHH WUDLQLQJ FHUWLILFDWLRQ FRXUVH DWWKH IROORZLQJ VLWH KWWS OHDUQSURFRUHFRPSURFRUHFHUWLILFDWLRQVXEFRQWUDFWRU 7KH&RQWUDFWRULVUHVSRQVLEOHIRU REWDLQLQJWKHLURZQWHFKQLFDOVXSSRUWDVQHHGHGHLWKHUWKURXJKRQOLQHWUDLQLQJRUE\FRQWDFWLQJ WKH3URFRUHVXSSRUWWHDP7KH&RQWUDFWRUVKDOOUHJXODUO\FKHFN3URFRUHDQGUHYLHZXSGDWHG GRFXPHQWVDVWKH\DUHDGGHG7KHUHZLOOEHQRFRVWWRWKH&RQWUDFWRUIRUWKHXVHRI3URFRUH 7KH&RQWUDFWRUVKDOOSURYLGHDWOHDVWRQHRQVLWHLQGLYLGXDOZLWKPRELOHDFFHVVWRWKH3URFRUH $SS WR SURYLGH UHDOWLPH DFFHVV WR FXUUHQW DQG XSGDWHG GUDZLQJV VSHFLILFDWLRQV 5),V Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 5HYLVHG&RQWUDFW1R$3DJHRI VXEPLWWDOVVFKHGXOHVFKDQJHRUGHUVDQGRWKHUSURMHFWGRFXPHQWVDVZHOODVDQ\GHILFLHQW REVHUYDWLRQVRUSXQFKOLVWLWHPV7KH&RQWUDFWRUVKDOOSRVWDOOFRPPXQLFDWLRQVDGGUHVVHGWRWKH (QJLQHHUDQGVKDOOUHYLHZDQGDFWRQDOOFRPPXQLFDWLRQVDGGUHVVHGWRWKH&RQWUDFWRULQWKH 3URFRUH$SS7KHXVHRI3URFRUHGRHVQRWUHOLHYHWKHFRQWUDFWRURIDQ\RWKHUUHTXLUHPHQWVDV PD\EHVSHFLILHGLQWKH&RQWUDFW'RFXPHQWV 3URFRUHIRU:LQGRZVL26 KWWSV DSSVDSSOHFRPXVDSSSURFRUHFRQVWUXFWLRQ PDQDJHPHQWLG 3URFRUHIRU$QGURLG KWWSV SOD\JRRJOHFRPVWRUHDSSVGHWDLOV"LG FRPSURFRUHDFWLYLWLHV :25.72%('21(7KH&RQWUDFWRUVKDOOSHUIRUPDOOZRUNQHFHVVDU\WRFRPSOHWHWKH &RQWUDFW LQ D VDWLVIDFWRU\ PDQQHU 8QOHVV RWKHUZLVH SURYLGHG WKH &RQWUDFWRU VKDOO IXUQLVK DOO PDWHULDOVHTXLSPHQWWRROVODERUDQGLQFLGHQWDOVQHFHVVDU\WRFRPSOHWHWKH:RUN 68%685)$&( '$7$ $OO VRLO DQG WHVW KROH GDWD ZDWHU WDEOH HOHYDWLRQV DQG VRLORU JURXQGZDWHUDQDO\VHVVKRZQRQWKHGUDZLQJVRULQFOXGHGLQWKH6SHFLILFDWLRQVDSSO\RQO\DWWKH ORFDWLRQRIWKHWHVWKROHVDQGWRWKHGHSWKVLQGLFDWHG6RLOWHVWUHSRUWVIRUWHVWKROHVZKLFKKDYH EHHQGULOOHGDUHDYDLODEOHIRULQVSHFWLRQDWWKHRIILFHRIWKH(QJLQHHU 7KH&RQWUDFWRUPD\PDNHLQGHSHQGHQWLQYHVWLJDWLRQVRIWKHSURMHFWVLWHLQFOXGLQJHYDOXDWLRQRI WKHVRLORUJURXQGZDWHUFRQGLWLRQVDQGRUWKHSUHVHQFHRIURFN LQ RUGHU WR FKDUDFWHUL]HWKH VXEVXUIDFHFRQGLWLRQVWKDWPD\EHHQFRXQWHUHGWRWKH&RQWUDFWRU¶VVDWLVIDFWLRQ7KHFRVWVIRU VXFKLQYHVWLJDWLRQVVKDOOEHFRQVLGHUHGLQFOXGHGLQWKHELGSULFHDQGQRDGGLWLRQDOFRPSHQVDWLRQ ZLOOEHPDGHWKHUHIRU 7KHLQGLFDWHGHOHYDWLRQRIWKHZDWHUWDEOHLVWKDWZKLFKH[LVWHGRQWKHGDWHZKHQWHVWKROHGDWD ZDVGHWHUPLQHG,WLVWKH&RQWUDFWRU¶VUHVSRQVLELOLW\WRGHWHUPLQHDQGDOORZIRUWKHHOHYDWLRQRI JURXQGZDWHUDWWKHWLPHRISURMHFWFRQVWUXFWLRQ$GLIIHUHQFHLQHOHYDWLRQEHWZHHQJURXQGZDWHU VKRZQLQVRLOERULQJORJVDQGJURXQGZDWHUDFWXDOO\HQFRXQWHUHGGXULQJFRQVWUXFWLRQZLOOQRWEH FRQVLGHUHGDVDEDVLVIRUH[WUDZRUN 5,*+72):$< 5LJKWVRIZD\ HDVHPHQWV RU ULJKWVRIHQWU\ IRU WKH :RUN ZKHQ LQGLFDWHGRQWKH3ODQVZLOOEHSURYLGHGE\WKH$JHQF\8QOHVVRWKHUZLVHSURYLGHGWKH&RQWUDFWRU VKDOOPDNHDUUDQJHPHQWVSD\IRUDQGDVVXPHDOOUHVSRQVLELOLW\IRUDFTXLULQJXVLQJDQGUHVWRULQJ DGGLWLRQDO ZRUN DUHDV DQG UHPRYLQJ DQGRU GLVSRVLQJ RI IDFLOLWLHV WHPSRUDULO\ UHTXLUHG 7KH &RQWUDFWRUVKDOOLQGHPQLI\DQGKROGWKHDJHQF\KDUPOHVVIURPDOOFODLPVIRUGDPDJHVFDXVHGE\ VXFKDFWLRQV 6859(<,1* *HQHUDO7KH&RQWUDFWRUZLOOSHUIRUPDQGEHUHVSRQVLEOHIRUWKHDFFXUDF\RIVXUYH\LQJ DGHTXDWHIRUFRQVWUXFWLRQ7KH&RQWUDFWRUVKDOOVHWDQGSUHVHUYHFRQVWUXFWLRQVXUYH\VWDNHV DQGPDUNVIRUWKHGXUDWLRQRIWKHLUXVHIXOQHVV,IDQ\FRQVWUXFWLRQVXUYH\VWDNHVDUHORVWRU GLVWXUEHGDQGQHHGWREHUHSODFHGVXFKUHSODFHPHQWVKDOOEHSHUIRUPHGDWWKHH[SHQVHRIWKH &RQWUDFWRU 7KH &RQWUDFWRU VKDOO QRWLI\ WKH (QJLQHHU LQ ZULWLQJ DW OHDVW :RUNLQJ 'D\V EHIRUH VXUYH\ VHUYLFHVLQFRQQHFWLRQZLWKWKHOD\LQJRXWRIDQ\SRUWLRQRIWKH:RUN7KH&RQWUDFWRUVKDOOVHWDOO VWDNHVIRUOLQHDQGJUDGH6HWWLQJWROHUDQFHVIRUFRQVWUXFWLRQVWDNLQJVKDOOFRQIRUPZLWK&KDSWHU &RQVWUXFWLRQ 6XUYH\V RI WKH &DOWUDQV 6XUYH\V 0DQXDO 6XUYH\LQJ WR GHWHUPLQH WKH Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 5HYLVHG&RQWUDFW1R$3DJHRI ERXQGDULHVRIWKHSXEOLFULJKWRIZD\RUHDVHPHQWVVKDOOFRQIRUPZLWK&KDSWHU5LJKWRI:D\ 6XUYH\V 8QOHVV RWKHUZLVH VSHFLILHG LQ WKH 6SHFLDO 3URYLVLRQV VWDNHV ZLOO EH VHW DQG VWDWLRQHG IRU DOLJQPHQWV IRU SLSHOLQHV VHZHUV VWRUP GUDLQV SRWDEOH ZDWHUUHF\FOHG ZDWHU DQG WKHLU DSSXUWHQDQFHV FXUEV KHDGHUV VWUXFWXUHV URXJK JUDGH ILQLVKJUDGH DQG ULJKWRIZD\ RU HDVHPHQWERXQGDULHV$FRUUHVSRQGLQJFXWRUILOOWRILQLVKHGJUDGH RUIORZOLQH ZLOOEHLQGLFDWHG RQDJUDGHVKHHW 3HUPDQHQW 6XUYH\ 0DUNHUV 7KH &RQWUDFWRU VKDOO QRW FRYHU RU GLVWXUE SHUPDQHQW VXUYH\PRQXPHQWVRUEHQFKPDUNVZLWKRXWWKHFRQVHQWRIWKH(QJLQHHU:KHUHWKH(QJLQHHU FRQFXUV LQ ZULWLQJ ZLWK WKH &RQWUDFWRU WKDW SURWHFWLQJ DQ H[LVWLQJ PRQXPHQW LQ SODFH LV LPSUDFWLFDOWKH&RQWUDFWRUVKDOOHPSOR\DOLFHQVHGODQGVXUYH\RURUDUHJLVWHUHGFLYLOHQJLQHHU DXWKRUL]HG WR SUDFWLFH ODQG VXUYH\LQJ ZLWKLQ WKH 6WDWH RI &DOLIRUQLD KHUHLQDIWHU 6XUYH\RU WR HVWDEOLVKWKHORFDWLRQRIWKHPRQXPHQWEHIRUHLWLVGLVWXUEHG7KH&RQWUDFWRUVKDOOKDYHWKH PRQXPHQWUHSODFHGE\WKH6XUYH\RUQRODWHUWKDQWKLUW\ GD\VDIWHUFRQVWUXFWLRQDWWKHVLWHRI WKHUHSODFHPHQWLVFRPSOHWHG7KH6XUYH\RUVKDOOILOHFRUQHUUHFRUG V DVUHTXLUHGE\ DQGHWVHTRIWKH&DOLIRUQLD%XVLQHVVDQG3URIHVVLRQV&RGH 7KH&RQWUDFWRUVKDOOKDYHD5HFRUGRI6XUYH\SUHSDUHGE\WKH6XUYH\RU DQG ILOH LW LQ FRQIRUPDQFHZLWKRIWKH6WDWHRI&DOLIRUQLD%XVLQHVVDQG3URIHVVLRQV&RGHZKHQ WKH6XUYH\RUSHUIRUPVDQ\VXUYH\LQJWKDWVXFKPDSLVUHTXLUHGXQGHURIWKH6WDWHRI &DOLIRUQLD%XVLQHVVDQG3URIHVVLRQV&RGHDQGZKHQHYHUWKH6XUYH\RUVKDOOHVWDEOLVKVHWRU FRQVWUXFWDQ\SHUPDQHQWVXUYH\PRQXPHQW6'56'UDZLQJ1R0W\SHPRQXPHQWVEROWV VSLNHV OHDGHG WDFNV DQG QDLOV ZKHQ VHW LQ FRQFUHWH LURQ SLSHV UHLQIRUFLQJ VWHHO DQG DOO PRQXPHQWVDQGPDUNVWKDWDUHDWRUDFFHVVRU\WRSURSHUW\FRUQHUVDQGVWUHHWFHQWHUOLQHVDUH SHUPDQHQWVXUYH\PRQXPHQWV7KH5HFRUGRI6XUYH\VKDOOVKRZDOOPRQXPHQWVVHWFRQWURO PRQXPHQWVXVHGWKHEDVLVRIEHDULQJVDQGDOORWKHUGDWDQHHGHGWRGHWHUPLQHWKHSURFHGXUHRI VXUYH\DQGWKHGHJUHHRIDFFXUDF\DWWDLQHGE\WKHILHOGVXUYH\LQJLQFOXGLQJWKHXQDGMXVWHGUDWLR RIFORVXUH7KHXQDGMXVWHGUDWLRRIFORVXUHVKDOOQRWH[FHHGSDUWLQ7KH5HFRUGRI 6XUYH\VKDOOVKRZWKHORFDWLRQDQGMXVWLILFDWLRQRIORFDWLRQRIDOOSHUPDQHQWPRQXPHQWVVHWDQG WKHLU UHODWLRQ WR WKH VWUHHW ULJKWRIZD\ 5HFRUG V RI 6XUYH\ V VKDOO EH VXEPLWWHG IRU WKH (QJLQHHU¶VUHYLHZDQGDSSURYDOEHIRUHVXEPLWWDOWRWKH&RXQW\6XUYH\RUDQGEHIRUHVXEPLWWDOWR WKH&RXQW\5HFRUGHU :KHQDFKDQJHLVPDGHLQWKHILQLVKHGHOHYDWLRQRIWKHSDYHPHQWRIDQ\URDGZD\LQZKLFKD SHUPDQHQWVXUYH\PRQXPHQWLVORFDWHGWKH&RQWUDFWRUVKDOODGMXVWWKHPRQXPHQWIUDPHDQG FRYHUWRWKHQHZJUDGHZLWKLQGD\VRISDYLQJXQOHVVWKH(QJLQHHUVKDOODSSURYHRWKHUZLVH 0RQXPHQWIUDPHVDQGFRYHUVVKDOOEHSURWHFWHGGXULQJVWUHHWVHDOLQJRUSDLQWLQJSURMHFWVRUEH FOHDQHGWRWKHVDWLVIDFWLRQRIWKH(QJLQHHU /LQHDQG*UDGH$OOZRUNVKDOOFRQIRUPWRWKHOLQHVHOHYDWLRQVDQGJUDGHVVKRZQRQ WKH3ODQV 7KUHHFRQVHFXWLYHSRLQWVVHWRQWKHVDPHVORSHVKDOOEHXVHGWRJHWKHUVRWKDWDQ\YDULDWLRQ IURPDVWUDLJKWJUDGHFDQEHGHWHFWHG$Q\VXFKYDULDWLRQVKDOOEHUHSRUWHGWRWKH(QJLQHHU,Q WKHDEVHQFHRIVXFKUHSRUWWKH&RQWUDFWRUVKDOOEHUHVSRQVLEOHIRUDQ\HUURULQWKHJUDGHRIWKH :RUN *UDGHVIRUXQGHUJURXQGFRQGXLWVZLOOEHVHWDWWKHVXUIDFHRIWKHJURXQG7KH&RQWUDFWRUVKDOO WUDQVIHUWKHPWRWKHERWWRPRIWKHWUHQFK Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 5HYLVHG&RQWUDFW1R$3DJHRI 3D\PHQW IRU 6XUYH\3D\PHQWIRUVXUYH\ZRUNVKDOOEHLQFOXGHGLQWKHELGLWHPV UHTXLULQJWKHVXUYH\ZRUNDQGQRDGGLWLRQDOSD\PHQWZLOOEHPDGH([WHQVLRQRIXQLWSULFHVIRU H[WUDZRUNVKDOOLQFOXGHIXOOFRPSHQVDWLRQIRUDWWHQGDQWVXUYH\ZRUNDQGQRDGGLWLRQDOSD\PHQW ZLOOEHPDGH 3D\PHQWIRUWKHUHSODFHPHQWRIGLVWXUEHGPRQXPHQWVDQGWKHILOLQJRIUHFRUGVRIVXUYH\DQGRU FRUQHUUHFRUGVLQFOXGLQJILOLQJIHHVVKDOOEHLQFOXGHGLQWKHFRQWUDFWSULFHIRU5HSODFH6XUYH\ 0RQXPHQW,IQRVXFKELGLWHPLVOLVWHGLQWKHELGSD\PHQWVKDOOEHFRQVLGHUHGLQFLGHQWDOWRWKH :RUNQHFHVVLWDWLQJWKHGLVWXUEDQFHRIVDLGPRQXPHQWVDQGQRDGGLWLRQDOSD\PHQWZLOOEHPDGH $87+25,7< 2) %2$5' $1' (1*,1((5 7KH %RDUG KDV WKH ILQDO DXWKRULW\ LQ DOO PDWWHUVDIIHFWLQJWKH:RUN:LWKLQWKHVFRSHRIWKH&RQWUDFWWKH(QJLQHHUKDVWKHDXWKRULW\WR HQIRUFHFRPSOLDQFHZLWKWKH3ODQVDQG6SHFLILFDWLRQV7KH&RQWUDFWRUVKDOOSURPSWO\FRPSO\ZLWK LQVWUXFWLRQVIURPWKH(QJLQHHURUDQDXWKRUL]HGUHSUHVHQWDWLYH 7KH GHFLVLRQ RI WKH (QJLQHHU LVILQDO DQG ELQGLQJ RQ DOO TXHVWLRQV UHODWLQJ WR TXDQWLWLHV DFFHSWDELOLW\RIPDWHULDOHTXLSPHQWRUZRUN H[HFXWLRQSURJUHVVRUVHTXHQFHRIZRUN DQG LQWHUSUHWDWLRQRIWKH3ODQV6SHFLILFDWLRQVRURWKHUGUDZLQJV7KLVVKDOOEHSUHFHGHQWWRDQ\ SD\PHQWXQGHUWKH&RQWUDFWXQOHVVRWKHUZLVHRUGHUHGE\WKH%RDUG $YDLODELOLW\ RI 5HFRUGV 7KH &RQWUDFWRU VKDOO DW QR FKDUJH WR WKH$JHQF\ SURYLGH FRSLHVRIDOOUHFRUGVLQWKH&RQWUDFWRU¶VRUVXEFRQWUDFWRU¶VSRVVHVVLRQSHUWDLQLQJWRWKHZRUN WKDWWKH(QJLQHHUPD\UHTXHVW $XGLWDQG,QVSHFWLRQ &RQWUDFWRU DJUHHV WR PDLQWDLQ DQGRU PDNH DYDLODEOH WR WKH (QJLQHHUZLWKLQ6DQ'LHJR&RXQW\DFFXUDWHERRNVDQGDFFRXQWLQJUHFRUGVUHODWLYHWRDOOLWV DFWLYLWLHVDQGWRFRQWUDFWXDOO\UHTXLUHDOOVXEFRQWUDFWRUVWRWKLV&RQWUDFWWRGRWKHVDPH7KH (QJLQHHU VKDOO KDYH WKH ULJKW WR PRQLWRU DVVHVV DQG HYDOXDWH&RQWUDFWRU¶V DQG LWV VXEFRQWUDFWRUV¶SHUIRUPDQFHSXUVXDQWWRWKLV$JUHHPHQWVDLGPRQLWRULQJDVVHVVPHQWVDQG HYDOXDWLRQVWRLQFOXGHEXWQRWEHOLPLWHGWRDXGLWVLQVSHFWLRQRISUHPLVHVUHSRUWVFRQWUDFWV VXEFRQWUDFWV DQG LQWHUYLHZV RI &RQWUDFWRU¶V VWDII DQG WKH VWDII RI DOO VXEFRQWUDFWRUV WR WKLV FRQWUDFW$WDQ\WLPHGXULQJQRUPDOEXVLQHVVKRXUVDQGDVRIWHQDVWKH(QJLQHHUPD\GHHP QHFHVVDU\XSRQUHDVRQDEOHDGYDQFHQRWLFH&RQWUDFWRUVKDOOPDNHDYDLODEOHWRWKH(QJLQHHU IRUH[DPLQDWLRQDOORILWVDQGDOOVXEFRQWUDFWRUVWRWKLVFRQWUDFWUHFRUGVZLWKUHVSHFWWRDOO PDWWHUVFRYHUHGE\WKLV&RQWUDFWDQGZLOOSHUPLWWKH(QJLQHHUWRDXGLWH[DPLQHFRS\DQGPDNH H[FHUSWVRUWUDQVFULSWVIURPVXFKGDWDDQGUHFRUGVDQGWRPDNHDXGLWVRIDOOLQYRLFHVPDWHULDOV SD\UROOVUHFRUGVRISHUVRQQHODQGRWKHUGDWDUHODWLQJWRDOOPDWWHUVFRYHUHGE\WKLV&RQWUDFW +RZHYHU DQ\ VXFK DFWLYLWLHV VKDOO EH FDUULHG RXW LQ D PDQQHU VR DV WR QRW XQUHDVRQDEO\ LQWHUIHUHZLWK&RQWUDFWRU¶VRQJRLQJEXVLQHVVRSHUDWLRQV&RQWUDFWRUDQGDOOVXEFRQWUDFWRUVWR WKLVFRQWUDFWVKDOOPDLQWDLQVXFKGDWDDQGUHFRUGVIRUDVORQJDVPD\EHUHTXLUHGE\DSSOLFDEOH ODZVDQGUHJXODWLRQV ,163(&7,21 7KH :RUN LV VXEMHFW WR LQVSHFWLRQ DQG DSSURYDO E\ WKH (QJLQHHU 7KH &RQWUDFWRUVKDOOQRWLI\WKH(QJLQHHUEHIRUHQRRQRIWKHZRUNLQJGD\EHIRUHLQVSHFWLRQLVUHTXLUHG :RUNVKDOOEHGRQHRQO\LQWKHSUHVHQFHRIWKH(QJLQHHUXQOHVVRWKHUZLVHDXWKRUL]HG$Q\ZRUN GRQH ZLWKRXW SURSHU LQVSHFWLRQ ZLOO EH VXEMHFW WR UHMHFWLRQ 7KH (QJLQHHU DQG DQ\ DXWKRUL]HG UHSUHVHQWDWLYHVVKDOODWDOOWLPHVKDYHDFFHVVWRWKH:RUNGXULQJLWVFRQVWUXFWLRQDWVKRSVDQG \DUGV DV ZHOO DV WKH SURMHFW VLWH 7KH &RQWUDFWRU VKDOO SURYLGH HYHU\ UHDVRQDEOH IDFLOLW\ IRU DVFHUWDLQLQJ WKDW WKH PDWHULDOV DQG ZRUNPDQVKLS DUH LQ DFFRUGDQFH ZLWK WKHVH 6SHFLILFDWLRQV ,QVSHFWLRQRIWKH:RUNVKDOOQRWUHOLHYHWKH&RQWUDFWRURIWKHREOLJDWLRQWRIXOILOODOOFRQGLWLRQVRIWKH &RQWUDFW Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 5HYLVHG&RQWUDFW1R$3DJHRI 6(&7,21±&+$1*(6,1:25. &+$1*(65(48(67('%<7+(&2175$&725 *HQHUDO &KDQJHV LQ WKH 3ODQV DQG 6SHFLILFDWLRQV UHTXHVWHG LQ ZULWLQJE\ WKH &RQWUDFWRUZKLFKGRQRWPDWHULDOO\DIIHFWWKH:RUNDQGZKLFKDUHQRWGHWULPHQWDOWRWKH:RUNRU WR WKH LQWHUHVWV RI WKH $JHQF\ PD\ EH JUDQWHG E\ WKH (QJLQHHU 1RWKLQJ KHUHLQ VKDOO EH FRQVWUXHGDVJUDQWLQJDULJKWWRWKH&RQWUDFWRUWRGHPDQGDFFHSWDQFHRIVXFKFKDQJHV 3D\PHQWIRU&KDQJHV5HTXHVWHGE\WKH&RQWUDFWRU,IVXFKFKDQJHVDUHJUDQWHG WKH\VKDOOEHPDGHDWDUHGXFWLRQLQFRVWRUQRDGGLWLRQDOFRVWWRWKH$JHQF\ &+$1*(6,1,7,$7('%<7+($*(1&< *HQHUDO7KH$JHQF\PD\FKDQJHWKH3ODQV6SHFLILFDWLRQVFKDUDFWHURIWKHZRUNRU TXDQWLW\RIZRUNSURYLGHGWKHWRWDODULWKPHWLFGROODUYDOXHRIDOOVXFKFKDQJHVERWKDGGLWLYHDQG GHGXFWLYHGRHVQRWH[FHHGSHUFHQWRIWKH&RQWUDFW3ULFH6KRXOGLWEHFRPHQHFHVVDU\WR H[FHHGWKLVOLPLWDWLRQWKHFKDQJHVKDOOEHE\ZULWWHQ6XSSOHPHQWDO$JUHHPHQWEHWZHHQWKH &RQWUDFWRUDQG$JHQF\XQOHVVERWKSDUWLHVDJUHHWRSURFHHGZLWKWKHFKDQJHE\&KDQJH2UGHU &KDQJH 2UGHUV VKDOO EH LQ ZULWLQJ DQG VWDWH WKH GROODU YDOXH RI WKH FKDQJH RU HVWDEOLVKHG PHWKRGRISD\PHQWDQ\DGMXVWPHQWLQFRQWUDFWWLPHRIFRPSOHWLRQDQGZKHQQHJRWLDWHGSULFHV DUHLQYROYHGVKDOOSURYLGHIRUWKH&RQWUDFWRU¶VVLJQDWXUHLQGLFDWLQJDFFHSWDQFH 3D\PHQW &RQWUDFW8QLW3ULFHV,IDFKDQJHLVRUGHUHGLQDQLWHPRIZRUNFRYHUHGE\D&RQWUDFW 8QLW3ULFHDQGVXFKFKDQJHGRHVQRWLQYROYHVXEVWDQWLDOFKDQJHLQFKDUDFWHURIWKHZRUNIURP WKDWVKRZQRQWKH3ODQVRUVSHFLILHGLQWKH6SHFLILFDWLRQVWKHQDQDGMXVWPHQWLQSD\PHQWZLOOEH PDGH7KLVDGMXVWPHQWZLOOEHEDVHGXSRQWKHLQFUHDVHRUGHFUHDVHLQTXDQWLW\DQGWKH&RQWUDFW 8QLW3ULFH ,IWKHDFWXDOTXDQWLW\RIDQLWHPRIZRUNFRYHUHGE\D&RQWUDFW8QLW3ULFHDQGFRQVWUXFWHGLQ FRQIRUPDQFHZLWKWKH3ODQVDQG6SHFLILFDWLRQVYDULHVIURPWKH%LGTXDQWLW\E\SHUFHQWRU OHVVSD\PHQWZLOOEHPDGHDWWKH&RQWUDFW8QLW3ULFH,IWKHDFWXDOTXDQWLW\RIVDLGLWHPRIZRUN YDULHVIURPWKH%LGTXDQWLW\E\PRUHWKDQSHUFHQWSD\PHQWZLOOEHPDGHSHU6HFWLRQ RUDVDSSURSULDWH ,IDFKDQJHLVRUGHUHGLQDQLWHPRIZRUNFRYHUHGE\D&RQWUDFW8QLW3ULFHDQGVXFKFKDQJH GRHVLQYROYHDVXEVWDQWLDOFKDQJHLQWKHFKDUDFWHURIWKHZRUNIURPWKDWVKRZQRQWKH3ODQVRU VSHFLILHGLQWKH6SHFLILFDWLRQVDQDGMXVWPHQWLQSD\PHQWZLOOEHPDGHSHU6HFWLRQ ,QFUHDVHVRI0RUH7KDQ3HUFHQW6KRXOGWKHDFWXDOTXDQWLW\RIDQLWHPRIZRUN FRYHUHG E\ D &RQWUDFW 8QLW 3ULFH DQG FRQVWUXFWHG LQ FRQIRUPDQFH ZLWK WKH 3ODQV DQG 6SHFLILFDWLRQVH[FHHGWKH%LGTXDQWLW\E\PRUHWKDQSHUFHQWSD\PHQWIRUWKHTXDQWLW\LQ H[FHVVRISHUFHQWRIWKH%LGTXDQWLW\ZLOOEHPDGHRQWKHEDVLVRIDQDGMXVWPHQWLQWKH &RQWUDFW8QLW3ULFHPXWXDOO\DJUHHGWRE\WKH&RQWUDFWRUDQGWKH$JHQF\RUDWWKHRSWLRQRIWKH (QJLQHHURQWKHEDVLVRI([WUD:RUNSHU6HFWLRQ7KH([WUD:RUNSHU6HFWLRQEDVLVRI SD\PHQWVKDOOQRWLQFOXGHIL[HGFRVWV)L[HGFRVWVVKDOOEHGHHPHGWRKDYHEHHQUHFRYHUHGE\ WKH&RQWUDFWRUWKURXJKSD\PHQWIRUSHUFHQWRIWKH%LGTXDQWLW\DWWKH&RQWUDFW8QLW3ULFH Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 5HYLVHG&RQWUDFW1R$3DJHRI 'HFUHDVHVRI0RUH7KDQ3HUFHQW6KRXOGWKHDFWXDOTXDQWLW\RIDQLWHPRIZRUN FRYHUHG E\ D &RQWUDFW 8QLW 3ULFH DQG FRQVWUXFWHG LQ FRQIRUPDQFH ZLWK WKH 3ODQV DQG 6SHFLILFDWLRQVEHOHVVWKDQSHUFHQWRIWKH%LGTXDQWLW\DQDGMXVWPHQWLQSD\PHQWZLOOQRWEH PDGHXQOHVVVRUHTXHVWHGLQZULWLQJE\WKH&RQWUDFWRU,IWKH&RQWUDFWRUVRUHTXHVWVSD\PHQW ZLOOEHPDGHRQWKHEDVLVRIDQDGMXVWPHQWLQWKH&RQWUDFW8QLW3ULFHPXWXDOO\DJUHHGWRE\WKH &RQWUDFWRUDQGWKH$JHQF\RUDWWKHRSWLRQRIWKH(QJLQHHURQWKHEDVLVRI([WUD:RUNSHU 6HFWLRQ KRZHYHU LQ QR FDVH ZLOO SD\PHQW EH OHVV WKDQ ZRXOG EH PDGH IRU WKH DFWXDO TXDQWLW\DWWKH&RQWUDFW8QLW3ULFHQRUPRUHWKDQZRXOGEHPDGHIRUSHUFHQWRIWKH%LG TXDQWLW\DWWKH&RQWUDFW8QLW3ULFH 6WLSXODWHG8QLW3ULFHV6WLSXODWHG8QLW3ULFHVDUHXQLWSULFHVHVWDEOLVKHGE\WKH$JHQF\ LQ WKH &RQWUDFW 'RFXPHQWV DV GLVWLQJXLVKHG IURP &RQWUDFW 8QLW 3ULFHV VXEPLWWHG E\ WKH &RQWUDFWRU6WLSXODWHG8QLW3ULFHVPD\EHXVHGIRUWKHDGMXVWPHQWRI&RQWUDFWFKDQJHVZKHQVR VSHFLILHGLQWKH6SHFLDO3URYLVLRQV $JUHHG3ULFHV$JUHHG3ULFHVDUHSULFHVIRUQHZRUXQIRUHVHHQZRUNRUDGMXVWPHQWVLQ &RQWUDFW 8QLW 3ULFHV SHU 6HFWLRQ HVWDEOLVKHG E\ PXWXDO DJUHHPHQW EHWZHHQ WKH &RQWUDFWRUDQGWKH$JHQF\,IPXWXDODJUHHPHQWFDQQRWEHUHDFKHGWKH(QJLQHHUPD\GLUHFW WKH&RQWUDFWRUWRSURFHHGRQWKHEDVLVRI([WUD:RUNLQDFFRUGDQFHSHU6HFWLRQH[FHSWDV RWKHUZLVHVSHFLILHGLQ6HFWLRQVDQG 6FKHGXOHRI9DOXHV3ULRUWRFRQVWUXFWLRQ&RQWUDFWRUVKDOOSURYLGHDVFKHGXOHRIYDOXHV IRUDOOOXPSVXPELGLWHPVWKDWVKDOOEHXVHGIRUWKHSXUSRVHRISURJUHVVSD\PHQWV7KHSULFHV VKDOOEHYDOLGIRUWKHSXUSRVHRIFKDQJHRUGHUVWRWKHSURMHFW (OLPLQDWHG,WHPV6KRXOGDQ\%LGLWHPEHHOLPLQDWHGLQLWVHQWLUHW\SD\PHQWZLOOEH PDGHWRWKH&RQWUDFWRUIRULWVDFWXDOFRVWVLQFXUUHGLQFRQQHFWLRQZLWKWKHHOLPLQDWHGLWHPSULRU WRQRWLILFDWLRQLQZULWLQJIURPWKH(QJLQHHUVRVWDWLQJLWVHOLPLQDWLRQ,IPDWHULDOFRQIRUPLQJWRWKH 3ODQVDQG6SHFLILFDWLRQVLVRUGHUHGE\WKH&RQWUDFWRUIRUXVHLQWKHHOLPLQDWHGLWHPSULRUWRWKH GDWHRIQRWLILFDWLRQRIHOLPLQDWLRQE\WKH(QJLQHHUDQGLIWKHRUGHUIRUWKDWPDWHULDOFDQQRWEH FDQFHOHGSD\PHQWZLOOEHPDGHWRWKH&RQWUDFWRUIRUWKHDFWXDOFRVWRIWKHPDWHULDO,QWKLV FDVH WKH PDWHULDO VKDOO EHFRPH WKH SURSHUW\ RI WKH $JHQF\ 3D\PHQW ZLOO EH PDGH WR WKH &RQWUDFWRUIRULWVDFWXDOFRVWVIRUDQ\IXUWKHUKDQGOLQJ,IWKHPDWHULDOLVUHWXUQDEOHWKHPDWHULDO VKDOOEHUHWXUQHGDQGSD\PHQWZLOOEHPDGHWRWKH&RQWUDFWRUIRUWKHDFWXDOFRVWRIFKDUJHV PDGHE\WKHVXSSOLHUIRUUHWXUQLQJWKHPDWHULDODQGIRUKDQGOLQJE\WKH&RQWUDFWRU$FWXDOFRVWV DVXVHGKHUHLQVKDOOEHFRPSXWHGRQWKHEDVLVRI([WUD:RUNSHU6HFWLRQ (;75$:25. *HQHUDO1HZRUXQIRUHVHHQZRUNZLOOEHFODVVLILHGDV³H[WUDZRUN´ZKHQWKH(QJLQHHU GHWHUPLQHVWKDWLWLVQRWFRYHUHGE\&RQWUDFW8QLW3ULFHVRUVWLSXODWHGXQLWSULFHV 3D\PHQW *HQHUDO:KHQWKHSULFHIRUWKHH[WUDZRUNFDQQRWEHDJUHHGXSRQWKH$JHQF\ZLOOSD\ IRUWKHH[WUDZRUNEDVHGRQWKHDFFXPXODWLRQRIFRVWVDVSURYLGHGKHUHLQ Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 5HYLVHG&RQWUDFW1R$3DJHRI %DVLVIRU(VWDEOLVKLQJ&RVWV D /DERU7KHFRVWVRIODERUZLOOEHWKHDFWXDOFRVWIRUZDJHVRIZRUNHUVSHUIRUPLQJWKHH[WUD ZRUN DWWKHWLPHWKHH[WUDZRUNLVGRQHSOXVHPSOR\HUSD\PHQWVRISD\UROOWD[HVZRUNHUV FRPSHQVDWLRQ LQVXUDQFH OLDELOLW\LQVXUDQFH KHDOWK DQG ZHOIDUH SHQVLRQ YDFDWLRQ DSSUHQWLFHVKLSIXQGVDQGRWKHUGLUHFWFRVWVUHVXOWLQJIURP)HGHUDO6WDWHRUORFDOODZVDVZHOO DVDVVHVVPHQWVRUEHQHILWVUHTXLUHGE\ODZIXOFROOHFWLYHEDUJDLQLQJDJUHHPHQWV 7KHXVHRIDODERUFODVVLILFDWLRQZKLFKZRXOGLQFUHDVHWKHH[WUDZRUNFRVWZLOOQRWEHSHUPLWWHG XQOHVV WKH &RQWUDFWRU HVWDEOLVKHV WKH QHFHVVLW\ IRU VXFK DGGLWLRQDO FRVWV /DERU FRVWV IRU HTXLSPHQWRSHUDWRUVDQGKHOSHUVVKDOOEHUHSRUWHGRQO\ZKHQVXFKFRVWVDUHQRWLQFOXGHGLQWKH LQYRLFHIRUHTXLSPHQWUHQWDO7KHODERUFRVWIRUIRUHPHQVKDOOEHSURSRUWLRQHGWRDOORIWKHLU DVVLJQHGZRUNDQGRQO\WKDWDSSOLFDEOHWRH[WUDZRUNZLOOEHSDLG 1RQGLUHFW ODERU FRVWV LQFOXGLQJ VXSHULQWHQGHQFH VKDOO EH FRQVLGHUHGSDUWRIWKHPDUNXSRI 6HFWLRQ D E 0DWHULDOV7KHFRVWRIPDWHULDOVUHSRUWHGVKDOOEHDWLQYRLFHRUORZHVWFXUUHQWSULFHDWZKLFK VXFKPDWHULDOVDUHORFDOO\DYDLODEOHDQGGHOLYHUHGWRWKHMREVLWHLQWKHTXDQWLWLHVLQYROYHGSOXV VDOHVWD[IUHLJKWDQGGHOLYHU\ 7KH $JHQF\ UHVHUYHV WKH ULJKW WR DSSURYH PDWHULDOV DQG VRXUFHVRI VXSSO\ RU WR VXSSO\ PDWHULDOVWR WKH &RQWUDFWRU LI QHFHVVDU\IRUWKH SURJUHVV RI WKH :RUN 1RPDUNXS VKDOO EH DSSOLHGWRDQ\PDWHULDOSURYLGHGE\WKH$JHQF\ F 7RRODQG(TXLSPHQW5HQWDO1RSD\PHQWZLOOEHPDGHIRUWKHXVHRIWRROVZKLFKKDYHD UHSODFHPHQWYDOXHRIRUOHVV 5HJDUGOHVVRIRZQHUVKLSWKHUDWHVDQGULJKWRIZD\GHOD\IDFWRUVWREHXVHGLQGHWHUPLQLQJ UHQWDO DQG GHOD\ FRVWV VKDOO EH WKH HGLWLRQ RI WKH ³/DERU 6XUFKDUJH DQG (TXLSPHQW 5HQWDO 5DWHV´SXEOLVKHGE\&DOWUDQVFXUUHQWDWWKHWLPHRIWKHDFWXDOXVHRIWKHWRRORUHTXLSPHQW7KH ULJKWRIZD\GHOD\IDFWRUVWKHUHLQVKDOOEHXVHGDVPXOWLSOLHUVRIWKHUHQWDOUDWHVIRUGHWHUPLQLQJ WKHYDOXHRIFRVWVIRUGHOD\WRWKH&RQWUDFWRUDQGVXEFRQWUDFWRUVLIDQ\7KHODERUVXUFKDUJH UDWHVSXEOLVKHGWKHUHLQDUHQRWDSDUWRIWKLVFRQWUDFW 7KH UHQWDO UDWHV SDLG VKDOO LQFOXGH WKH FRVW RI IXHO RLO OXEULFDWLRQ VXSSOLHV VPDOO WRROV QHFHVVDU\DWWDFKPHQWVUHSDLUVDQGPDLQWHQDQFHRIDQ\NLQGGHSUHFLDWLRQVWRUDJHLQVXUDQFH DQGDOOLQFLGHQWDOV1HFHVVDU\ORDGLQJDQGWUDQVSRUWDWLRQFRVWVIRUHTXLSPHQWXVHGRQWKHH[WUD ZRUNVKDOOEHLQFOXGHG ,IHTXLSPHQWLVXVHGLQWHUPLWWHQWO\DQGZKHQQRWLQXVHFRXOGEHUHWXUQHGWRLWVUHQWDOVRXUFHDW OHVVH[SHQVHWRWKH$JHQF\WKDQKROGLQJLWDWWKH:RUNVLWHLWVKDOOEHUHWXUQHGXQOHVVWKH &RQWUDFWRUHOHFWVWRNHHSLWDWWKH:RUNVLWHDWQRH[SHQVHWRWKH$JHQF\ $OOHTXLSPHQWVKDOOEHDFFHSWDEOHWRWKH(QJLQHHULQJRRGZRUNLQJFRQGLWLRQDQGVXLWDEOHIRU WKHSXUSRVHIRUZKLFKLWLVWREHXVHG0DQXIDFWXUHU¶VUDWLQJVDQGDSSURYHGPRGLILFDWLRQVVKDOO EHXVHGWRFODVVLI\HTXLSPHQWDQGLWVKDOOEHSRZHUHGE\DXQLWRIDWOHDVWWKHPLQLPXPUDWLQJ UHFRPPHQGHGE\WKHPDQXIDFWXUHU Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 5HYLVHG&RQWUDFW1R$3DJHRI 7KHUHSRUWHGUHQWDOWLPHIRUHTXLSPHQWDOUHDG\DWWKH:RUNVLWHVKDOOEHWKHGXUDWLRQRILWVXVH RQWKHH[WUDZRUN7KLVWLPHEHJLQVZKHQHTXLSPHQWLVILUVWSXWLQWRDFWXDORSHUDWLRQRQWKHH[WUD ZRUNSOXVWKHWLPHUHTXLUHGWRPRYHLWIURPLWVSUHYLRXVVLWHDQGEDFNRUWRDFORVHUVLWH G 2WKHU,WHPV7KH$JHQF\PD\DXWKRUL]HRWKHULWHPVZKLFKPD\EHUHTXLUHGRQWKHH[WUD ZRUNLQFOXGLQJODERUVHUYLFHVPDWHULDODQGHTXLSPHQW7KHVHLWHPVPXVWEHGLIIHUHQWLQWKHLU QDWXUH IURP WKRVH UHTXLUHG IRU WKH :RUN DQG EH RI D W\SH QRW RUGLQDULO\ DYDLODEOH IURP WKH &RQWUDFWRURU6XEFRQWUDFWRUV ,QYRLFHVFRYHULQJDOOVXFKLWHPVLQGHWDLOVKDOOEHVXEPLWWHGZLWKWKHUHTXHVWIRUSD\PHQW H ,QYRLFHV9HQGRUV¶LQYRLFHVIRUPDWHULDOHTXLSPHQWUHQWDODQGRWKHUH[SHQGLWXUHVVKDOOEH VXEPLWWHG ZLWK WKH UHTXHVW IRU SD\PHQW ,I WKH UHTXHVW IRU SD\PHQW LV QRW VXEVWDQWLDWHG E\ LQYRLFHVRURWKHUGRFXPHQWDWLRQWKH$JHQF\PD\HVWDEOLVKWKHFRVWRIWKHLWHPLQYROYHGDWWKH ORZHVWSULFHZKLFKZDVFXUUHQWDWWKHWLPHRIWKHUHSRUW 0DUNXS D :RUN E\ &RQWUDFWRU 7KH IROORZLQJ SHUFHQWDJHV VKDOO EH DGGHG WR WKH &RQWUDFWRU V FRVWVDQGVKDOOFRQVWLWXWHWKHPDUNXSIRUDOORYHUKHDGDQGSURILWV /DERU««««««««««« 0DWHULDOV««««««««« (TXLSPHQW5HQWDO«««««« 2WKHU,WHPVDQG([SHQGLWXUHV 7RWKHVXPRIWKHFRVWVDQGPDUNXSVSURYLGHGIRULQWKLVVHFWLRQSHUFHQWVKDOOEHDGGHGDV FRPSHQVDWLRQIRUERQGLQJ E :RUN E\ 6XEFRQWUDFWRU :KHQ DOO RU DQ\ SDUW RI WKH H[WUD ZRUN LV SHUIRUPHG E\ D 6XEFRQWUDFWRU WKH PDUNXS HVWDEOLVKHG LQ 6HFWLRQ D VKDOO EH DSSOLHG WR WKH 6XEFRQWUDFWRU VDFWXDOFRVWRIVXFKZRUN$PDUNXSRISHUFHQWRQWKHILUVWRIWKH VXEFRQWUDFWHGSRUWLRQRIWKHH[WUDZRUNDQGDPDUNXSRISHUFHQWRQZRUNDGGHGLQH[FHVVRI RIWKHVXEFRQWUDFWHGSRUWLRQRIWKHH[WUDZRUNPD\EHDGGHGE\WKH&RQWUDFWRU 'DLO\ 5HSRUWV E\ &RQWUDFWRU:KHQWKHSULFHIRUWKHH[WUDZRUNFDQQRWEHDJUHHG XSRQ WKH &RQWUDFWRU VKDOO VXEPLW D GDLO\ UHSRUW WRWKH (QJLQHHU RQIRUPV DSSURYHG E\ WKH $JHQF\ ,QFOXGHG DUH DSSOLFDEOH GHOLYHU\ WLFNHWV OLVWLQJ DOO ODERU PDWHULDOV DQG HTXLSPHQW LQYROYHGIRUWKDWGD\DQGRWKHUVHUYLFHVDQGH[SHQGLWXUHVZKHQDXWKRUL]HG3D\PHQWIRUH[WUD ZRUNZLOOQRWEHPDGHXQWLOVXFKWLPHWKDWWKH&RQWUDFWRUVXEPLWVFRPSOHWHGGDLO\UHSRUWVDQGDOO VXSSRUWLQJGRFXPHQWVWRWKH(QJLQHHU)DLOXUHWRVXEPLWWKHGDLO\UHSRUWE\WKHFORVHRIWKHQH[W ZRUNLQJGD\PD\ZDLYHDQ\ULJKWVIRUWKDWGD\$QDWWHPSWVKDOOEHPDGHWRUHFRQFLOHWKHUHSRUW GDLO\DQGLWVKDOOEHVLJQHGE\WKH(QJLQHHUDQGWKH&RQWUDFWRU,QWKHHYHQWRIGLVDJUHHPHQW SHUWLQHQW QRWHV VKDOO EH HQWHUHG E\ HDFK SDUW\ WR H[SODLQ SRLQWV ZKLFK FDQQRW EH UHVROYHG LPPHGLDWHO\(DFKSDUW\VKDOOUHWDLQDVLJQHGFRS\RIWKHUHSRUW5HSRUWVE\6XEFRQWUDFWRUVRU RWKHUVVKDOOEHVXEPLWWHGWKURXJKWKH&RQWUDFWRU 7KHUHSRUWVKDOO 6KRZQDPHVRIZRUNHUVFODVVLILFDWLRQVDQGKRXUVZRUNHG 'HVFULEHDQGOLVWTXDQWLWLHVRIPDWHULDOVXVHG Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 5HYLVHG&RQWUDFW1R$3DJHRI 6KRZW\SHRIHTXLSPHQWVL]HLGHQWLILFDWLRQQXPEHUDQGKRXUVRIRSHUDWLRQLQFOXGLQJ ORDGLQJDQGWUDQVSRUWDWLRQLIDSSOLFDEOH 'HVFULEHRWKHUVHUYLFHVDQGH[SHQGLWXUHVLQVXFKGHWDLODVWKH$JHQF\PD\UHTXLUH &+$1*(' &21',7,216 7KH &RQWUDFWRU VKDOO SURPSWO\ QRWLI\ WKH (QJLQHHU RI WKH IROORZLQJ ZRUN VLWH FRQGLWLRQV KHUHLQDIWHU FDOOHG FKDQJHG FRQGLWLRQV LQ ZULWLQJ XSRQ WKHLU GLVFRYHU\DQGEHIRUHWKH\DUHGLVWXUEHG 6XEVXUIDFHRUODWHQWSK\VLFDOFRQGLWLRQVGLIIHULQJPDWHULDOO\IURPWKRVHUHSUHVHQWHGLQ WKH&RQWUDFW'RFXPHQWV 8QNQRZQ SK\VLFDO FRQGLWLRQV RI DQ XQXVXDO QDWXUH GLIIHULQJ PDWHULDOO\ IURP WKRVH RUGLQDULO\HQFRXQWHUHGDQGJHQHUDOO\UHFRJQL]HGDVLQKHUHQWLQZRUNRIWKHFKDUDFWHU EHLQJSHUIRUPHG DQG 0DWHULDOGLIIHULQJIURPWKDWUHSUHVHQWHGLQWKH&RQWUDFWZKLFKWKH&RQWUDFWRUEHOLHYHV PD\EHKD]DUGRXVZDVWHDVGHILQHGLQ6HFWLRQRIWKH+HDOWKDQG6DIHW\&RGH WKDW LV UHTXLUHG WR EH UHPRYHG WR D &ODVV , &ODVV ,, RU &ODVV,,,GLVSRVDOVLWHLQ DFFRUGDQFHZLWKSURYLVLRQVRIH[LVWLQJODZ 7KH(QJLQHHUZLOOSURPSWO\LQYHVWLJDWHFRQGLWLRQVZKLFKDSSHDUWREHFKDQJHGFRQGLWLRQV,IWKH (QJLQHHU GHWHUPLQHV WKDW FRQGLWLRQV DUH FKDQJHG FRQGLWLRQV DQGWKH\ ZLOO PDWHULDOO\ DIIHFW SHUIRUPDQFH WLPH WKH &RQWUDFWRU XSRQ VXEPLWWLQJDZULWWHQUHTXHVW ZLOO EH JUDQWHG DQ H[WHQVLRQRIWLPHVXEMHFWWRWKHSURYLVLRQVRI ,IWKH(QJLQHHUGHWHUPLQHVWKDWWKHFRQGLWLRQVGRQRWMXVWLI\DQDGMXVWPHQWLQFRPSHQVDWLRQWKH &RQWUDFWRUZLOOEHQRWLILHGLQZULWLQJ7KLVQRWLFHZLOODOVRDGYLVHWKH&RQWUDFWRURILWVREOLJDWLRQWR QRWLI\WKH(QJLQHHULQZULWLQJLIWKH&RQWUDFWRUGLVDJUHHV 7KH&RQWUDFWRU¶VIDLOXUHWRJLYHQRWLFHRIFKDQJHGFRQGLWLRQVSURPSWO\XSRQWKHLUGLVFRYHU\DQG EHIRUHWKH\DUHGLVWXUEHGVKDOOFRQVWLWXWHDZDLYHURIDOOFODLPVLQFRQQHFWLRQWKHUHZLWK 7KH&RQWUDFWRUVKDOOQRWEHHQWLWOHGWRWKHSD\PHQWRIDQ\DGGLWLRQDOFRPSHQVDWLRQIRUDQ\DFW RUIDLOXUHWRDFWE\WKH(QJLQHHULQFOXGLQJIDLOXUHRUUHIXVDOWRLVVXHDFKDQJHRUGHURUIRUWKH KDSSHQLQJRIDQ\HYHQWWKLQJRFFXUUHQFHRURWKHUFDXVHXQOHVVWKH&RQWUDFWRUVKDOOKDYHILUVW JLYHQWKH(QJLQHHUGXHZULWWHQQRWLFHRISRWHQWLDOFODLPDVKHUHLQDIWHUVSHFLILHG&RPSOLDQFH ZLWKWKLVVHFWLRQVKDOOQRWEHUHTXLUHGDVDSUHUHTXLVLWHWRQRWLFHSURYLVLRQVLQ6HFWLRQ &RQWUDFW7LPH$FFRXQWLQJQRUWRDQ\FODLPWKDWLVEDVHGRQGLIIHUHQFHVLQPHDVXUHPHQWRU HUURUVRIFRPSXWDWLRQDVWRFRQWUDFWTXDQWLWLHV7KHZULWWHQQRWLFHRISRWHQWLDOFODLPIRUFKDQJHG FRQGLWLRQVVKDOOEHVXEPLWWHGE\WKH&RQWUDFWRUWRWKH(QJLQHHUXSRQWKHLUGLVFRYHU\DQGSULRUWR WKH WLPH WKDW WKH &RQWUDFWRU SHUIRUPV WKH ZRUN JLYLQJ ULVH WR WKH SRWHQWLDO FODLP 7KH &RQWUDFWRU¶VIDLOXUHWRJLYHZULWWHQQRWLFHRISRWHQWLDOFODLPIRUFKDQJHGFRQGLWLRQVWRWKHDJHQF\ XSRQWKHLUGLVFRYHU\DQGEHIRUHWKH\DUHGLVWXUEHGVKDOOFRQVWLWXWHDZDLYHURIDOOFODLPVLQ FRQQHFWLRQWKHUHZLWK 7KH&RQWUDFWRUVKDOOSURYLGHWKH&LW\ZLWKDZULWWHQGRFXPHQWFRQWDLQLQJDGHVFULSWLRQRIWKH SDUWLFXODUFLUFXPVWDQFHVJLYLQJULVHWRWKHSRWHQWLDOFODLPWKHUHDVRQVIRUZKLFKWKH&RQWUDFWRU EHOLHYHVDGGLWLRQDOFRPSHQVDWLRQPD\EHGXHDQGQDWXUHRIDQ\DQGDOOFRVWVLQYROYHGZLWKLQ ZRUNLQJ GD\V RI WKH GDWH RI VHUYLFH RI WKH ZULWWHQ QRWLFH RI SRWHQWLDO FODLP IRU FKDQJHG FRQGLWLRQV9HUEDOQRWLILFDWLRQVDUHGLVDOORZHG 7KHSRWHQWLDOFODLPVKDOOLQFOXGHWKHIROORZLQJFHUWLILFDWLRQUHODWLYHWRWKH&DOLIRUQLD)DOVH&ODLPV $FW*RYHUQPHQW&RGH6HFWLRQV Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 5HYLVHG&RQWUDFW1R$3DJH RI ³7KH XQGHUVLJQHG FHUWLILHV WKDWWKH DERYH VWDWHPHQWV DUH PDGH LQ IXOO FRJQL]DQFH RI WKH &DOLIRUQLD)DOVH&ODLPV$FW*RYHUQPHQW&RGH6HFWLRQV7KHXQGHUVLJQHGIXUWKHU XQGHUVWDQGVDQGDJUHHVWKDWWKLVSRWHQWLDOFODLPXQOHVVUHVROYHGPXVWEHUHVWDWHGDVDFODLP LQUHVSRQVHWRWKH&LW\¶VSURSRVHGILQDOHVWLPDWHLQRUGHUIRULWWREHIXUWKHUFRQVLGHUHG´ %\ BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB 7LWOH BBBBBBBBBBBBBBBBBBBBBBBBBBBBBB 'DWH BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB &RPSDQ\1DPH BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB 7KH &RQWUDFWRU¶V HVWLPDWH RI FRVWV PD\ EH XSGDWHG ZKHQ DFWXDO FRVWV DUH NQRZQ 7KH &RQWUDFWRUVKDOOVXEPLWVXEVWDQWLDWLRQRILWVDFWXDOFRVWVWRWKH(QJLQHHUZLWKLQZRUNLQJGD\V DIWHUWKHDIIHFWHGZRUNLVFRPSOHWHG)DLOXUHWRGRVRVKDOOEHVXIILFLHQWFDXVHIRUGHQLDORIDQ\ FODLPVXEVHTXHQWO\ILOHGRQWKHEDVLVRIVDLGQRWLFHRISRWHQWLDOFODLP ,WLVWKHLQWHQWLRQRIWKLVVHFWLRQWKDWGLIIHUHQFHVEHWZHHQWKHSDUWLHVDULVLQJXQGHUDQGE\YLUWXH RIWKHFRQWUDFWEHEURXJKWWRWKHDWWHQWLRQRIWKH(QJLQHHUDWWKHHDUOLHVWSRVVLEOHWLPHLQRUGHU WKDWVXFKPDWWHUVEHVHWWOHGLISRVVLEOHRURWKHUDSSURSULDWHDFWLRQSURPSWO\WDNHQ ',6387(':25.7KH&RQWUDFWRUVKDOOJLYHWKH$JHQF\ZULWWHQQRWLFHRISRWHQWLDOFODLP SULRUWRFRPPHQFLQJDQ\GLVSXWHGZRUN)DLOXUHWRJLYHVDLGQRWLFHVKDOOFRQVWLWXWHDZDLYHURIDOO FODLPVLQFRQQHFWLRQWKHUHZLWK,IWKH&RQWUDFWRUDQGWKH$JHQF\DUHXQDEOHWRUHDFKDJUHHPHQW RQGLVSXWHGZRUNWKH$JHQF\PD\GLUHFWWKH&RQWUDFWRUWRSURFHHGZLWKWKH:RUN 3ULRU WR SURFHHGLQJ ZLWK GLVSXWH UHVROXWLRQ SXUVXDQW WR 3XEOLF&RQWUDFW &RGH SURYLVLRQV VSHFLILHGKHUHLQDIWHUWKHFRQWUDFWRUVKDOODWWHPSWWRUHVROYHDOOGLVSXWHVLQIRUPDOO\WKURXJKWKH IROORZLQJGLVSXWHUHVROXWLRQFKDLQRIFRPPDQG 3URMHFW,QVSHFWRU &RQVWUXFWLRQ0DQDJHU 'HSXW\&LW\(QJLQHHU &LW\(QJLQHHU ([HFXWLYH0DQDJHU&DUOVEDG0XQLFLSDO:DWHU'LVWULFW 7KH&RQWUDFWRUVKDOOVXEPLWDFRPSOHWHUHSRUWZLWKLQZRUNLQJGD\VDIWHUFRPSOHWLRQRIWKH GLVSXWHGZRUNVWDWLQJLWVSRVLWLRQRQWKHFODLPWKHFRQWUDFWXDOEDVLVIRUWKHFODLPDORQJZLWKDOO GRFXPHQWDWLRQVXSSRUWLQJWKHFRVWVDQGDOORWKHUHYLGHQWLDU\PDWHULDOV$WHDFKOHYHORIFODLPRU DSSHDORIFODLPWKH'LVWULFWZLOOZLWKLQZRUNLQJGD\VRIUHFHLSWRIVDLGFODLPRUDSSHDORI FODLPUHYLHZWKH&RQWUDFWRU¶VUHSRUWDQGUHVSRQGZLWKDSRVLWLRQUHTXHVWDGGLWLRQDOLQIRUPDWLRQ RUUHTXHVWWKDWWKH&RQWUDFWRUPHHWDQGSUHVHQWLWVUHSRUW:KHQDGGLWLRQDOLQIRUPDWLRQRUD PHHWLQJLVUHTXHVWHGWKH'LVWULFWZLOOSURYLGHLWVSRVLWLRQZLWKLQZRUNLQJGD\VRIUHFHLSWRI VDLGDGGLWLRQDOLQIRUPDWLRQRU&RQWUDFWRU¶VSUHVHQWDWLRQRILWVUHSRUW7KH&RQWUDFWRUPD\DSSHDO HDFK OHYHO¶V SRVLWLRQ XS WR WKH ([HFXWLYH 0DQDJHU DIWHU ZKLFK WKH &RQWUDFWRU PD\ SURFHHG XQGHUWKHSURYLVLRQVRIWKH3XEOLF&RQWUDFW&RGH 7KH DXWKRULW\ ZLWKLQ WKH GLVSXWH UHVROXWLRQ FKDLQ RI FRPPDQG LV OLPLWHG WR UHFRPPHQGLQJ D UHVROXWLRQWRDFODLPWRWKH([HFXWLYH0DQDJHU$FWXDODSSURYDORIWKHFODLPLVVXEMHFWWRWKH FKDQJHRUGHUSURYLVLRQVLQWKHFRQWUDFW Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 5HYLVHG&RQWUDFW1R$3DJHRI $OOFODLPVE\WKH&RQWUDFWRUVKDOOEHUHVROYHGLQDFFRUGDQFHZLWK3XEOLF&RQWUDFW&RGHVHFWLRQ ZKLFKLVVHWIRUWKEHORZ D 7KH/HJLVODWXUHILQGVDQGGHFODUHVWKDWLWLVLQWKHEHVWLQWHUHVWVRIWKHVWDWHDQGLWV FLWL]HQVWRHQVXUHWKDWDOOFRQVWUXFWLRQEXVLQHVVSHUIRUPHGRQDSXEOLFZRUNVSURMHFWLQWKHVWDWH WKDWLVFRPSOHWHDQGQRWLQGLVSXWHLVSDLGLQIXOODQGLQDWLPHO\PDQQHU E 1RWZLWKVWDQGLQJDQ\RWKHUODZLQFOXGLQJEXWQRWOLPLWHGWR$UWLFOH FRPPHQFLQJZLWK 6HFWLRQ RI&KDSWHURI3DUW&KDSWHU FRPPHQFLQJZLWK6HFWLRQ RI3DUW DQG$UWLFOH FRPPHQFLQJZLWK6HFWLRQ RI&KDSWHURI3DUWWKLVVHFWLRQVKDOODSSO\ WRDQ\FODLPE\DFRQWUDFWRULQFRQQHFWLRQZLWKDSXEOLFZRUNVSURMHFW F )RUSXUSRVHVRIWKLVVHFWLRQ ³&ODLP´PHDQVDVHSDUDWHGHPDQGE\DFRQWUDFWRUVHQWE\UHJLVWHUHGPDLORUFHUWLILHGPDLO ZLWKUHWXUQUHFHLSWUHTXHVWHGIRURQHRUPRUHRIWKHIROORZLQJ $ $WLPHH[WHQVLRQLQFOXGLQJZLWKRXWOLPLWDWLRQIRUUHOLHIIURPGDPDJHVRUSHQDOWLHVIRUGHOD\ DVVHVVHGE\DSXEOLFHQWLW\XQGHUDFRQWUDFWIRUDSXEOLFZRUNVSURMHFW % 3D\PHQWE\WKHSXEOLFHQWLW\RIPRQH\RUGDPDJHVDULVLQJIURPZRUNGRQHE\RURQEHKDOI RIWKHFRQWUDFWRUSXUVXDQWWRWKHFRQWUDFWIRUDSXEOLFZRUNVSURMHFWDQGSD\PHQWIRUZKLFKLV QRWRWKHUZLVHH[SUHVVO\SURYLGHGRUWRZKLFKWKHFODLPDQWLVQRWRWKHUZLVHHQWLWOHG & 3D\PHQWRIDQDPRXQWWKDWLVGLVSXWHGE\WKHSXEOLFHQWLW\ ³&RQWUDFWRU´PHDQVDQ\W\SHRIFRQWUDFWRUZLWKLQWKHPHDQLQJRI&KDSWHU FRPPHQFLQJ ZLWK6HFWLRQ RI'LYLVLRQRIWKH%XVLQHVVDQG3URIHVVLRQV&RGHZKRKDVHQWHUHGLQWRD GLUHFWFRQWUDFWZLWKDSXEOLFHQWLW\IRUDSXEOLFZRUNVSURMHFW $ ³3XEOLFHQWLW\´PHDQVZLWKRXWOLPLWDWLRQH[FHSWDVSURYLGHGLQVXESDUDJUDSK % DVWDWH DJHQF\ GHSDUWPHQW RIILFH GLYLVLRQ EXUHDX ERDUG RU FRPPLVVLRQ WKH &DOLIRUQLD 6WDWH 8QLYHUVLW\WKH8QLYHUVLW\RI&DOLIRUQLDDFLW\LQFOXGLQJDFKDUWHUFLW\FRXQW\LQFOXGLQJDFKDUWHU FRXQW\ FLW\ DQG FRXQW\ LQFOXGLQJ D FKDUWHU FLW\ DQG FRXQW\ GLVWULFW VSHFLDO GLVWULFW SXEOLF DXWKRULW\SROLWLFDOVXEGLYLVLRQSXEOLFFRUSRUDWLRQRUQRQSURILWWUDQVLWFRUSRUDWLRQZKROO\RZQHG E\DSXEOLFDJHQF\DQGIRUPHGWRFDUU\RXWWKHSXUSRVHVRIWKHSXEOLFDJHQF\ % ³3XEOLFHQWLW\´VKDOOQRWLQFOXGHWKHIROORZLQJ L 7KH 'HSDUWPHQW RI :DWHU 5HVRXUFHV DV WR DQ\ SURMHFW XQGHU WKH MXULVGLFWLRQ RI WKDW GHSDUWPHQW LL 7KH'HSDUWPHQWRI7UDQVSRUWDWLRQDVWRDQ\SURMHFWXQGHUWKHMXULVGLFWLRQRIWKDWGHSDUWPHQW LLL 7KH'HSDUWPHQWRI3DUNVDQG5HFUHDWLRQDVWRDQ\SURMHFWXQGHUWKHMXULVGLFWLRQRIWKDW GHSDUWPHQW LY 7KH 'HSDUWPHQW RI &RUUHFWLRQV DQG 5HKDELOLWDWLRQ ZLWK UHVSHFWWRDQ\SURMHFWXQGHULWV MXULVGLFWLRQSXUVXDQWWR&KDSWHU FRPPHQFLQJZLWK6HFWLRQ RI7LWOHRI3DUWRIWKH 3HQDO&RGH Y 7KH0LOLWDU\'HSDUWPHQWDVWRDQ\SURMHFWXQGHUWKHMXULVGLFWLRQRIWKDWGHSDUWPHQW YL 7KH'HSDUWPHQWRI*HQHUDO6HUYLFHVDVWRDOORWKHUSURMHFWV YLL 7KH+LJK6SHHG5DLO$XWKRULW\ ³3XEOLFZRUNVSURMHFW´PHDQVWKHHUHFWLRQFRQVWUXFWLRQDOWHUDWLRQUHSDLURULPSURYHPHQWRI DQ\SXEOLFVWUXFWXUHEXLOGLQJURDGRURWKHUSXEOLFLPSURYHPHQWRIDQ\NLQG ³6XEFRQWUDFWRU´PHDQVDQ\W\SHRIFRQWUDFWRUZLWKLQWKHPHDQLQJRI&KDSWHU FRPPHQFLQJ ZLWK6HFWLRQ RI'LYLVLRQRIWKH%XVLQHVVDQG3URIHVVLRQV&RGHZKRHLWKHULVLQGLUHFW FRQWUDFWZLWKDFRQWUDFWRURULVDORZHUWLHUVXEFRQWUDFWRU G $ 8SRQUHFHLSWRIDFODLPSXUVXDQWWRWKLVVHFWLRQWKHSXEOLFHQWLW\WRZKLFKWKHFODLP DSSOLHVVKDOOFRQGXFWDUHDVRQDEOHUHYLHZRIWKHFODLPDQGZLWKLQDSHULRGQRWWRH[FHHG GD\V VKDOO SURYLGH WKH FODLPDQW D ZULWWHQ VWDWHPHQW LGHQWLI\LQJ ZKDW SRUWLRQ RI WKH FODLP LV Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 5HYLVHG&RQWUDFW1R$3DJHRI GLVSXWHG DQG ZKDW SRUWLRQ LV XQGLVSXWHG 8SRQ UHFHLSW RI D FODLPDSXEOLFHQWLW\DQGD FRQWUDFWRUPD\E\PXWXDODJUHHPHQWH[WHQGWKHWLPHSHULRGSURYLGHGLQWKLVVXEGLYLVLRQ % 7KHFODLPDQWVKDOOIXUQLVKUHDVRQDEOHGRFXPHQWDWLRQWRVXSSRUWWKHFODLP & ,IWKHSXEOLFHQWLW\QHHGVDSSURYDOIURPLWVJRYHUQLQJERG\WRSURYLGHWKHFODLPDQWDZULWWHQ VWDWHPHQW LGHQWLI\LQJ WKH GLVSXWHG SRUWLRQ DQG WKH XQGLVSXWHG SRUWLRQ RI WKH FODLP DQG WKH JRYHUQLQJERG\GRHVQRWPHHWZLWKLQWKHGD\VRUZLWKLQWKHPXWXDOO\DJUHHGWRH[WHQVLRQRI WLPH IROORZLQJ UHFHLSW RI D FODLP VHQW E\ UHJLVWHUHG PDLO RU FHUWLILHG PDLO UHWXUQ UHFHLSW UHTXHVWHGWKHSXEOLFHQWLW\VKDOOKDYHXSWRWKUHHGD\VIROORZLQJWKHQH[WGXO\SXEOLFO\QRWLFHG PHHWLQJRIWKHJRYHUQLQJERG\DIWHUWKHGD\SHULRGRUH[WHQVLRQH[SLUHVWRSURYLGHWKH FODLPDQWDZULWWHQVWDWHPHQWLGHQWLI\LQJWKHGLVSXWHGSRUWLRQDQGWKHXQGLVSXWHGSRUWLRQ ' $Q\SD\PHQWGXHRQDQXQGLVSXWHGSRUWLRQRIWKHFODLPVKDOOEHSURFHVVHGDQGPDGHZLWKLQ GD\VDIWHUWKHSXEOLFHQWLW\LVVXHVLWVZULWWHQVWDWHPHQW,IWKHSXEOLFHQWLW\IDLOVWRLVVXHD ZULWWHQVWDWHPHQWSDUDJUDSK VKDOODSSO\ $ ,IWKHFODLPDQWGLVSXWHVWKHSXEOLFHQWLW\¶VZULWWHQUHVSRQVHRULIWKHSXEOLFHQWLW\IDLOVWR UHVSRQGWRDFODLPLVVXHGSXUVXDQWWRWKLVVHFWLRQZLWKLQWKHWLPHSUHVFULEHGWKHFODLPDQWPD\ GHPDQGLQZULWLQJDQLQIRUPDOFRQIHUHQFHWRPHHWDQGFRQIHUIRUVHWWOHPHQWRIWKHLVVXHVLQ GLVSXWH8SRQUHFHLSWRIDGHPDQGLQZULWLQJVHQWE\UHJLVWHUHGPDLORUFHUWLILHGPDLOUHWXUQ UHFHLSWUHTXHVWHGWKHSXEOLFHQWLW\VKDOOVFKHGXOHDPHHWDQGFRQIHUFRQIHUHQFHZLWKLQGD\V IRUVHWWOHPHQWRIWKHGLVSXWH % :LWKLQEXVLQHVVGD\VIROORZLQJWKHFRQFOXVLRQRIWKHPHHWDQGFRQIHUFRQIHUHQFHLIWKH FODLPRUDQ\SRUWLRQRIWKHFODLPUHPDLQVLQGLVSXWHWKHSXEOLFHQWLW\VKDOOSURYLGHWKHFODLPDQWD ZULWWHQVWDWHPHQWLGHQWLI\LQJWKHSRUWLRQRIWKHFODLPWKDWUHPDLQVLQGLVSXWHDQGWKHSRUWLRQWKDW LVXQGLVSXWHG$Q\SD\PHQWGXHRQDQXQGLVSXWHGSRUWLRQRIWKHFODLPVKDOOEHSURFHVVHGDQG PDGHZLWKLQGD\VDIWHUWKHSXEOLFHQWLW\LVVXHVLWVZULWWHQVWDWHPHQW$Q\GLVSXWHGSRUWLRQRI WKHFODLPDVLGHQWLILHGE\WKHFRQWUDFWRULQZULWLQJVKDOOEHVXEPLWWHGWRQRQELQGLQJPHGLDWLRQ ZLWKWKHSXEOLFHQWLW\DQGWKHFODLPDQWVKDULQJWKHDVVRFLDWHGFRVWVHTXDOO\7KHSXEOLFHQWLW\ DQGFODLPDQW VKDOO PXWXDOO\ DJUHHWRD PHGLDWRU ZLWKLQ EXVLQHVVGD\VDIWHUWKHGLVSXWHG SRUWLRQRIWKHFODLPKDVEHHQLGHQWLILHGLQZULWLQJ,IWKHSDUWLHVFDQQRWDJUHHXSRQDPHGLDWRU HDFKSDUW\VKDOOVHOHFWDPHGLDWRUDQGWKRVHPHGLDWRUVVKDOOVHOHFWDTXDOLILHGQHXWUDOWKLUGSDUW\ WRPHGLDWHZLWKUHJDUGWRWKHGLVSXWHGSRUWLRQRIWKHFODLP(DFKSDUW\VKDOOEHDUWKHIHHVDQG FRVWVFKDUJHGE\LWVUHVSHFWLYHPHGLDWRULQFRQQHFWLRQZLWKWKHVHOHFWLRQRIWKHQHXWUDOPHGLDWRU ,IPHGLDWLRQLVXQVXFFHVVIXOWKHSDUWVRIWKHFODLPUHPDLQLQJLQ GLVSXWH VKDOO EH VXEMHFW WR DSSOLFDEOHSURFHGXUHVRXWVLGHWKLVVHFWLRQ & )RUSXUSRVHVRIWKLVVHFWLRQPHGLDWLRQLQFOXGHVDQ\QRQELQGLQJSURFHVVLQFOXGLQJEXWQRW OLPLWHGWRQHXWUDOHYDOXDWLRQRUDGLVSXWHUHYLHZERDUGLQZKLFKDQLQGHSHQGHQWWKLUGSDUW\RU ERDUG DVVLVWV WKH SDUWLHV LQ GLVSXWH UHVROXWLRQ WKURXJK QHJRWLDWLRQ RU E\ LVVXDQFH RI DQ HYDOXDWLRQ$Q\PHGLDWLRQXWLOL]HGVKDOOFRQIRUPWRWKHWLPHIUDPHVLQWKLVVHFWLRQ ' 8QOHVVRWKHUZLVHDJUHHGWRE\WKHSXEOLFHQWLW\DQGWKHFRQWUDFWRULQZULWLQJWKHPHGLDWLRQ FRQGXFWHGSXUVXDQWWRWKLVVHFWLRQVKDOOH[FXVHDQ\IXUWKHUREOLJDWLRQXQGHU6HFWLRQWR PHGLDWHDIWHUOLWLJDWLRQKDVEHHQFRPPHQFHG ( 7KLVVHFWLRQGRHVQRWSUHFOXGHDSXEOLFHQWLW\IURPUHTXLULQJDUELWUDWLRQRIGLVSXWHVXQGHU SULYDWH DUELWUDWLRQ RU WKH 3XEOLF :RUNV &RQWUDFW $UELWUDWLRQ 3URJUDP LI PHGLDWLRQ XQGHU WKLV VHFWLRQGRHVQRWUHVROYHWKHSDUWLHV¶GLVSXWH )DLOXUHE\WKHSXEOLFHQWLW\WRUHVSRQGWRDFODLPIURPDFRQWUDFWRUZLWKLQWKHWLPHSHULRGV GHVFULEHGLQWKLVVXEGLYLVLRQRUWRRWKHUZLVHPHHWWKHWLPHUHTXLUHPHQWVRIWKLVVHFWLRQVKDOO UHVXOWLQWKHFODLPEHLQJGHHPHGUHMHFWHGLQLWVHQWLUHW\$FODLPWKDWLVGHQLHGE\UHDVRQRIWKH SXEOLFHQWLW\¶VIDLOXUHWRKDYHUHVSRQGHGWRDFODLPRULWVIDLOXUHWRRWKHUZLVHPHHWWKHWLPH UHTXLUHPHQWVRIWKLVVHFWLRQVKDOOQRWFRQVWLWXWHDQDGYHUVHILQGLQJZLWKUHJDUGWRWKHPHULWVRI WKHFODLPRUWKHUHVSRQVLELOLW\RUTXDOLILFDWLRQVRIWKHFODLPDQW $PRXQWVQRWSDLGLQDWLPHO\PDQQHUDVUHTXLUHGE\WKLVVHFWLRQVKDOOEHDULQWHUHVWDW SHUFHQWSHUDQQXP Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 5HYLVHG&RQWUDFW1R$3DJHRI ,IDVXEFRQWUDFWRURUDORZHUWLHUVXEFRQWUDFWRUODFNVOHJDOVWDQGLQJWRDVVHUWDFODLPDJDLQVW DSXEOLFHQWLW\EHFDXVHSULYLW\RIFRQWUDFWGRHVQRWH[LVWWKHFRQWUDFWRUPD\SUHVHQWWRWKH SXEOLFHQWLW\DFODLPRQEHKDOIRIDVXEFRQWUDFWRURUORZHUWLHUVXEFRQWUDFWRU$VXEFRQWUDFWRU PD\UHTXHVWLQZULWLQJHLWKHURQKLVRUKHURZQEHKDOIRURQEHKDOIRIDORZHUWLHUVXEFRQWUDFWRU WKDWWKHFRQWUDFWRUSUHVHQWDFODLPIRUZRUNZKLFKZDVSHUIRUPHGE\WKHVXEFRQWUDFWRURUE\D ORZHUWLHUVXEFRQWUDFWRURQEHKDOIRIWKHVXEFRQWUDFWRU7KHVXEFRQWUDFWRUUHTXHVWLQJWKDWWKH FODLPEHSUHVHQWHGWRWKHSXEOLFHQWLW\VKDOOIXUQLVKUHDVRQDEOHGRFXPHQWDWLRQWRVXSSRUWWKH FODLP :LWKLQ GD\V RI UHFHLSWRIWKLVZULWWHQUHTXHVWWKHFRQWUDFWRU VKDOO QRWLI\ WKH VXEFRQWUDFWRULQZULWLQJDVWRZKHWKHUWKHFRQWUDFWRUSUHVHQWHGWKHFODLPWRWKHSXEOLFHQWLW\DQG LIWKHRULJLQDOFRQWUDFWRUGLGQRWSUHVHQWWKHFODLPSURYLGHWKHVXEFRQWUDFWRUZLWKDVWDWHPHQWRI WKHUHDVRQVIRUQRWKDYLQJGRQHVR H 7KHWH[WRIWKLVVHFWLRQRUDVXPPDU\RILWVKDOOEHVHWIRUWKLQWKHSODQVRUVSHFLILFDWLRQVIRU DQ\SXEOLFZRUNVSURMHFWWKDWPD\JLYHULVHWRDFODLPXQGHUWKLVVHFWLRQ I $ZDLYHURIWKHULJKWVJUDQWHGE\WKLVVHFWLRQLVYRLGDQGFRQWUDU\WRSXEOLFSROLF\SURYLGHG KRZHYHUWKDW XSRQUHFHLSWRIDFODLPWKHSDUWLHVPD\PXWXDOO\DJUHHWRZDLYHLQZULWLQJ PHGLDWLRQDQGSURFHHGGLUHFWO\WRWKHFRPPHQFHPHQWRIDFLYLODFWLRQRUELQGLQJDUELWUDWLRQDV DSSOLFDEOH DQG DSXEOLFHQWLW\PD\SUHVFULEHUHDVRQDEOHFKDQJHRUGHUFODLPDQGGLVSXWH UHVROXWLRQSURFHGXUHVDQGUHTXLUHPHQWVLQDGGLWLRQWRWKHSURYLVLRQVRIWKLVVHFWLRQVRORQJDV WKH FRQWUDFWXDO SURYLVLRQV GR QRW FRQIOLFW ZLWK RU RWKHUZLVH LPSDLU WKH WLPHIUDPHV DQG SURFHGXUHVVHWIRUWKLQWKLVVHFWLRQ J 7KLVVHFWLRQDSSOLHVWRFRQWUDFWVHQWHUHGLQWRRQRUDIWHU-DQXDU\ K 1RWKLQJLQWKLVVHFWLRQVKDOOLPSRVHOLDELOLW\XSRQDSXEOLFHQWLW\WKDWPDNHVORDQVRUJUDQWV DYDLODEOHWKURXJKDFRPSHWLWLYHDSSOLFDWLRQSURFHVVIRUWKHIDLOXUHRIDQDZDUGHHWRPHHWLWV FRQWUDFWXDOREOLJDWLRQV L 7KLVVHFWLRQVKDOOUHPDLQLQHIIHFWRQO\XQWLO-DQXDU\DQGDVRIWKDWGDWHLVUHSHDOHG XQOHVVDODWHUHQDFWHGVWDWXWHWKDWLVHQDFWHGEHIRUH-DQXDU\GHOHWHVRUH[WHQGVWKDW GDWH ,QDGGLWLRQDOOFODLPVE\&RQWUDFWRUIRURUOHVVVKDOOEHUHVROYHGLQDFFRUGDQFHZLWK WKH SURFHGXUHV LQ WKH 3XEOLF &RQWUDFW &RGH 'LYLVLRQ 3DUW &KDSWHU $UWLFOH FRPPHQFLQJZLWK6HFWLRQ ZKLFKLVVHWIRUWKEHORZ $57,&/(5(62/87,212)&216758&7,21&/$,06 D 7KLV DUWLFOH DSSOLHV WR DOO SXEOLF ZRUNV FODLPV RI WKUHH KXQGUHG VHYHQW\ILYH WKRXVDQGGROODUV RUOHVVZKLFKDULVHEHWZHHQDFRQWUDFWRUDQGDORFDODJHQF\ 7KLVDUWLFOHVKDOOQRWDSSO\WRDQ\FODLPVUHVXOWLQJIURPDFRQWUDFWEHWZHHQDFRQWUDFWRUDQGD SXEOLFDJHQF\ZKHQWKHSXEOLFDJHQF\KDVHOHFWHGWRUHVROYHDQ\GLVSXWHVSXUVXDQWWR$UWLFOH FRPPHQFLQJZLWK6HFWLRQ RI&KDSWHURI3DUW E 3XEOLFZRUNKDVWKHVDPHPHDQLQJDVLQ6HFWLRQVDQGRIWKH&LYLO&RGH H[FHSWWKDWSXEOLFZRUNGRHVQRWLQFOXGHDQ\ZRUNRULPSURYHPHQWFRQWUDFWHGIRUE\WKHVWDWH RUWKH5HJHQWVRIWKH8QLYHUVLW\RI&DOLIRUQLD &ODLPPHDQVDVHSDUDWHGHPDQGE\WKHFRQWUDFWRUIRU $ DWLPHH[WHQVLRQ % SD\PHQWRI PRQH\RUGDPDJHVDULVLQJIURPZRUNGRQHE\RURQEHKDOIRIWKHFRQWUDFWRUSXUVXDQWWRWKH FRQWUDFWIRUDSXEOLFZRUNDQGSD\PHQWRIZKLFKLVQRWRWKHUZLVHH[SUHVVO\SURYLGHGIRURUWKH Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 5HYLVHG&RQWUDFW1R$3DJHRI FODLPDQWLVQRWRWKHUZLVHHQWLWOHGWRRU & DQDPRXQWWKHSD\PHQWRIZKLFKLVGLVSXWHGE\WKH ORFDODJHQF\ F 7KH SURYLVLRQV RI WKLV DUWLFOH RU D VXPPDU\ WKHUHRI VKDOO EHVHWIRUWKLQWKHSODQVRU VSHFLILFDWLRQVIRUDQ\ZRUNZKLFKPD\JLYHULVHWRDFODLPXQGHUWKLVDUWLFOH G 7KLVDUWLFOHDSSOLHVRQO\WRFRQWUDFWVHQWHUHGLQWRRQRUDIWHU-DQXDU\ )RUDQ\FODLPVXEMHFWWRWKLVDUWLFOHWKHIROORZLQJUHTXLUHPHQWVDSSO\ D 7KHFODLPVKDOOEHLQZULWLQJDQGLQFOXGHWKHGRFXPHQWVQHFHVVDU\WRVXEVWDQWLDWHWKHFODLP &ODLPVPXVWEHILOHGRQRUEHIRUHWKHGDWHRIILQDOSD\PHQW1RWKLQJ LQ WKLV VXEGLYLVLRQ LV LQWHQGHG WR H[WHQG WKH WLPH OLPLW RU VXSHUVHGH QRWLFH UHTXLUHPHQWV RWKHUZLVH SURYLGHG E\ FRQWUDFWIRUWKHILOLQJRIFODLPV E )RUFODLPVRIOHVVWKDQILIW\WKRXVDQGGROODUV WKHORFDODJHQF\VKDOOUHVSRQGLQ ZULWLQJWRDQ\ZULWWHQFODLPZLWKLQGD\VRIUHFHLSWRIWKHFODLPRUPD\UHTXHVWLQZULWLQJ ZLWKLQGD\VRIUHFHLSWRIWKHFODLPDQ\DGGLWLRQDOGRFXPHQWDWLRQVXSSRUWLQJWKHFODLPRU UHODWLQJWRGHIHQVHVWRWKHFODLPWKHORFDODJHQF\PD\KDYHDJDLQVWWKHFODLPDQW ,IDGGLWLRQDOLQIRUPDWLRQLVWKHUHDIWHUUHTXLUHGLWVKDOOEHUHTXHVWHGDQGSURYLGHGSXUVXDQWWR WKLVVXEGLYLVLRQXSRQPXWXDODJUHHPHQWRIWKHORFDODJHQF\DQGWKHFODLPDQW 7KHORFDODJHQF\ VZULWWHQUHVSRQVHWRWKHFODLPDVIXUWKHUGRFXPHQWHGVKDOOEHVXEPLWWHG WRWKHFODLPDQWZLWKLQGD\VDIWHUUHFHLSWRIWKHIXUWKHUGRFXPHQWDWLRQRUZLWKLQDSHULRGRI WLPH QR JUHDWHU WKDQ WKDW WDNHQ E\ WKH FODLPDQW LQ SURGXFLQJ WKH DGGLWLRQDO LQIRUPDWLRQ ZKLFKHYHULVJUHDWHU F )RUFODLPVRIRYHUILIW\WKRXVDQGGROODUV DQGOHVVWKDQRUHTXDOWRWKUHHKXQGUHG VHYHQW\ILYHWKRXVDQGGROODUV WKHORFDODJHQF\VKDOOUHVSRQGLQZULWLQJWRDOOZULWWHQ FODLPVZLWKLQGD\VRIUHFHLSWRIWKHFODLPRUPD\UHTXHVWLQZULWLQJZLWKLQGD\VRIUHFHLSW RIWKHFODLPDQ\DGGLWLRQDOGRFXPHQWDWLRQVXSSRUWLQJWKHFODLPRUUHODWLQJWRGHIHQVHVWRWKH FODLPWKHORFDODJHQF\PD\KDYHDJDLQVWWKHFODLPDQW ,IDGGLWLRQDOLQIRUPDWLRQLVWKHUHDIWHUUHTXLUHGLWVKDOOEHUHTXHVWHGDQGSURYLGHGSXUVXDQWWR WKLVVXEGLYLVLRQXSRQPXWXDODJUHHPHQWRIWKHORFDODJHQF\DQGWKHFODLPDQW 7KHORFDODJHQF\ VZULWWHQUHVSRQVHWRWKHFODLPDVIXUWKHUGRFXPHQWHGVKDOOEHVXEPLWWHG WRWKHFODLPDQWZLWKLQGD\VDIWHUUHFHLSWRIWKHIXUWKHUGRFXPHQWDWLRQRUZLWKLQDSHULRGRI WLPH QR JUHDWHU WKDQ WKDW WDNHQ E\ WKH FODLPDQW LQ SURGXFLQJ WKH DGGLWLRQDO LQIRUPDWLRQ RU UHTXHVWHGGRFXPHQWDWLRQZKLFKHYHULVJUHDWHU G ,IWKHFODLPDQWGLVSXWHVWKHORFDODJHQF\ VZULWWHQUHVSRQVH RUWKH ORFDO DJHQF\IDLOVWR UHVSRQGZLWKLQWKHWLPHSUHVFULEHGWKHFODLPDQWPD\VRQRWLI\WKHORFDODJHQF\LQZULWLQJHLWKHU ZLWKLQGD\VRIUHFHLSWRIWKHORFDODJHQF\ VUHVSRQVHRUZLWKLQGD\VRIWKHORFDODJHQF\ V IDLOXUHWRUHVSRQGZLWKLQWKHWLPHSUHVFULEHGUHVSHFWLYHO\DQGGHPDQGDQLQIRUPDOFRQIHUHQFH WRPHHWDQGFRQIHUIRUVHWWOHPHQWRIWKHLVVXHVLQGLVSXWH8SRQDGHPDQGWKHORFDODJHQF\ VKDOOVFKHGXOHDPHHWDQGFRQIHUFRQIHUHQFHZLWKLQGD\VIRUVHWWOHPHQWRIWKHGLVSXWH H )ROORZLQJWKHPHHWDQGFRQIHUFRQIHUHQFHLIWKHFODLPRUDQ\SRUWLRQUHPDLQVLQGLVSXWHWKH FODLPDQWPD\ILOHDFODLPDVSURYLGHGLQ&KDSWHU FRPPHQFLQJZLWK6HFWLRQ DQG&KDSWHU FRPPHQFLQJZLWK6HFWLRQ RI3DUWRI'LYLVLRQRI7LWOHRIWKH*RYHUQPHQW&RGH )RUSXUSRVHVRIWKRVHSURYLVLRQVWKHUXQQLQJRIWKHSHULRGRIWLPHZLWKLQZKLFKDFODLPPXVWEH ILOHG VKDOO EH WROOHG IURP WKH WLPH WKH FODLPDQW VXEPLWV KLV RUKHUZULWWHQFODLPSXUVXDQWWR VXEGLYLVLRQ D XQWLOWKHWLPHWKDWFODLPLVGHQLHGDVDUHVXOWRIWKHPHHWDQGFRQIHUSURFHVV LQFOXGLQJDQ\SHULRGRIWLPHXWLOL]HGE\WKHPHHWDQGFRQIHUSURFHVV I 7KLVDUWLFOHGRHVQRWDSSO\WRWRUWFODLPVDQGQRWKLQJLQWKLVDUWLFOHLVLQWHQGHGQRUVKDOOEH FRQVWUXHGWRFKDQJHWKHWLPHSHULRGVIRUILOLQJWRUWFODLPVRUDFWLRQVVSHFLILHGE\&KDSWHU FRPPHQFLQJZLWK6HFWLRQ DQG&KDSWHU FRPPHQFLQJZLWK6HFWLRQ RI3DUWRI 'LYLVLRQRI7LWOHRIWKH*RYHUQPHQW&RGH Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 5HYLVHG&RQWUDFW1R$3DJHRI 7KHIROORZLQJSURFHGXUHVDUHHVWDEOLVKHGIRUDOOFLYLODFWLRQVILOHGWRUHVROYHFODLPV VXEMHFWWRWKLVDUWLFOH D :LWKLQGD\VEXWQRHDUOLHUWKDQGD\VIROORZLQJWKHILOLQJRUUHVSRQVLYHSOHDGLQJVWKH FRXUWVKDOOVXEPLWWKHPDWWHUWRQRQELQGLQJPHGLDWLRQXQOHVVZDLYHGE\PXWXDOVWLSXODWLRQRI ERWK SDUWLHV 7KH PHGLDWLRQ SURFHVV VKDOO SURYLGH IRU WKH VHOHFWLRQ ZLWKLQ GD\V E\ ERWK SDUWLHVRIDGLVLQWHUHVWHGWKLUGSHUVRQDVPHGLDWRUVKDOOEHFRPPHQFHGZLWKLQGD\VRIWKH VXEPLWWDODQGVKDOOEHFRQFOXGHGZLWKLQGD\VIURPWKHFRPPHQFHPHQWRIWKHPHGLDWLRQ XQOHVVDWLPHUHTXLUHPHQWLVH[WHQGHGXSRQDJRRGFDXVHVKRZLQJWRWKHFRXUWRUE\VWLSXODWLRQ RIERWKSDUWLHV,IWKHSDUWLHVIDLOWRVHOHFWDPHGLDWRUZLWKLQWKHGD\SHULRGDQ\SDUW\PD\ SHWLWLRQWKHFRXUWWRDSSRLQWWKHPHGLDWRU E ,IWKHPDWWHUUHPDLQVLQGLVSXWHWKHFDVHVKDOOEHVXEPLWWHGWRMXGLFLDODUELWUDWLRQSXUVXDQW WR &KDSWHU FRPPHQFLQJ ZLWK 6HFWLRQ RI7LWOH RI3DUW RIWKH &RGH RI &LYLO 3URFHGXUH QRWZLWKVWDQGLQJ 6HFWLRQ RI WKDW FRGH 7KH &LYLO 'LVFRYHU\ $FW RI $UWLFOH FRPPHQFLQJZLWK6HFWLRQ RI&KDSWHURI7LWOHRI3DUWRIWKH&RGHRI&LYLO SURFHGXUH VKDOODSSO\WRDQ\SURFHHGLQJEURXJKWXQGHUWKHVXEGLYLVLRQFRQVLVWHQWZLWKWKHUXOHV SHUWDLQLQJWRMXGLFLDODUELWUDWLRQ 1RWZLWKVWDQGLQJ DQ\ RWKHU SURYLVLRQ RI ODZ XSRQ VWLSXODWLRQ RI WKH SDUWLHV DUELWUDWRUV DSSRLQWHG IRU SXUSRVHV RI WKLV DUWLFOH VKDOO EH H[SHULHQFHG LQFRQVWUXFWLRQ ODZ DQG XSRQ VWLSXODWLRQRI WKH SDUWLHV PHGLDWRUV DQGDUELWUDWRUV VKDOOEHSDLGQHFHVVDU\ DQGUHDVRQDEOH KRXUO\UDWHVRISD\QRWWRH[FHHGWKHLUFXVWRPDU\UDWHDQGVXFKIHHVDQGH[SHQVHVVKDOOEH SDLGHTXDOO\E\WKHSDUWLHVH[FHSWLQWKHFDVHRIDUELWUDWLRQZKHUHWKHDUELWUDWRUIRUJRRGFDXVH GHWHUPLQHVDGLIIHUHQWGLYLVLRQ,QQRHYHQWVKDOOWKHVHIHHVRUH[SHQVHVEHSDLGE\VWDWHRU FRXQW\IXQGV ,QDGGLWLRQWR&KDSWHU FRPPHQFLQJZLWK6HFWLRQ 7LWOHRI3DUWRIWKH&RGHRI &LYLO3URFHGXUHDQ\SDUW\ZKRDIWHUUHFHLYLQJDQDUELWUDWLRQDZDUGUHTXHVWVDWULDOGHQRYREXW GRHVQRWREWDLQDPRUHIDYRUDEOHMXGJPHQWVKDOOLQDGGLWLRQWRSD\PHQWRIFRVWVDQGIHHVXQGHU WKDWFKDSWHUSD\WKHDWWRUQH\ VIHHVRIWKHRWKHUSDUW\DULVLQJRXWRIWKHWULDOGHQRYR F 7KH FRXUW PD\ XSRQ UHTXHVW E\ DQ\ SDUW\ RUGHU DQ\ ZLWQHVVHV WR SDUWLFLSDWH LQ WKH PHGLDWLRQRUDUELWUDWLRQSURFHVV D 1RORFDODJHQF\VKDOOIDLOWRSD\PRQH\DVWRDQ\SRUWLRQRIDFODLPZKLFKLV XQGLVSXWHGH[FHSWDVRWKHUZLVHSURYLGHGLQWKHFRQWUDFW E ,QDQ\VXLWILOHGXQGHU6HFWLRQWKHORFDODJHQF\VKDOOSD\LQWHUHVWDWWKHOHJDOUDWH RQDQ\DUELWUDWLRQDZDUGRUMXGJPHQW7KHLQWHUHVWVKDOOEHJLQWRDFFUXHRQWKHGDWHWKHVXLWLV ILOHGLQDFRXUWRIODZ $OWKRXJKQRWWREHFRQVWUXHGDVSURFHHGLQJXQGHUH[WUDZRUNSURYLVLRQVWKH&RQWUDFWRUVKDOO NHHSDQGIXUQLVKUHFRUGVRIGLVSXWHGZRUNLQDFFRUGDQFHZLWK6HFWLRQ Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 5HYLVHG&RQWUDFW1R$3DJHRI 6(&7,21±&21752/2)0$7(5,$/6 0$7(5,$/6$1':25.0$16+,3 *HQHUDO$OOPDWHULDOVSDUWVDQGHTXLSPHQWIXUQLVKHGE\WKH&RQWUDFWRULQWKH:RUN VKDOOEHQHZKLJKJUDGHDQGIUHHIURPGHIHFWV4XDOLW\RIZRUNVKDOOEHLQDFFRUGDQFHZLWKWKH JHQHUDOO\ DFFHSWHG VWDQGDUGV 0DWHULDO DQG ZRUN TXDOLW\ VKDOO EH VXEMHFW WR WKH (QJLQHHU¶V DSSURYDO 0DWHULDOVDQGZRUNTXDOLW\QRWFRQIRUPLQJWRWKHUHTXLUHPHQWVRIWKH6SHFLILFDWLRQVVKDOOEH FRQVLGHUHGGHIHFWLYHDQGZLOOEHVXEMHFWWRUHMHFWLRQ'HIHFWLYHZRUNRUPDWHULDOZKHWKHULQ SODFHRUQRWVKDOOEHUHPRYHGLPPHGLDWHO\IURPWKHVLWHE\WKH&RQWUDFWRUDWLWVH[SHQVHZKHQ VRGLUHFWHGE\WKH(QJLQHHU ,IWKH&RQWUDFWRUIDLOVWRUHSODFHDQ\GHIHFWLYHRUGDPDJHGZRUNRUPDWHULDODIWHUUHDVRQDEOH QRWLFH WKH (QJLQHHU PD\ FDXVH VXFK ZRUN RU PDWHULDOV WR EH UHSODFHG 7KHUHSODFHPHQW H[SHQVHZLOOEHGHGXFWHGIURPWKHDPRXQWWREHSDLGWRWKH&RQWUDFWRU 8VHG RU VHFRQGKDQG PDWHULDOV SDUWVDQGHTXLSPHQWPD\EHXVHGRQO\ LI SHUPLWWHG E\WKH 6SHFLILFDWLRQV 3URWHFWLRQRI:RUNDQG0DWHULDOV7KH&RQWUDFWRUVKDOOSURYLGHDQGPDLQWDLQVWRUDJH IDFLOLWLHV DQG HPSOR\ VXFK PHDVXUHV DV ZLOO SUHVHUYH WKH VSHFLILHG TXDOLW\ DQG ILWQHVV RI PDWHULDOVWREHXVHGLQWKH:RUN6WRUHGPDWHULDOVVKDOOEHUHDVRQDEO\DFFHVVLEOHIRULQVSHFWLRQ 7KH&RQWUDFWRUVKDOODOVRDGHTXDWHO\SURWHFWQHZDQGH[LVWLQJZRUNDQGDOOLWHPVRIHTXLSPHQW IRUWKHGXUDWLRQRIWKH&RQWUDFW 7KH&RQWUDFWRUVKDOOQRWZLWKRXWWKH$JHQF\¶VFRQVHQWDVVLJQVHOOPRUWJDJHK\SRWKHFDWHRU UHPRYH HTXLSPHQW RU PDWHULDOV ZKLFK KDYH EHHQ LQVWDOOHG RU GHOLYHUHG DQG ZKLFK PD\ EH QHFHVVDU\IRUWKHFRPSOHWLRQRIWKH&RQWUDFW ,QVSHFWLRQ5HTXLUHPHQWV *HQHUDO8QOHVVRWKHUZLVHVSHFLILHGLQVSHFWLRQLVUHTXLUHGDWWKHVRXUFHIRUVXFKW\SLFDO PDWHULDOV DQG IDEULFDWHG LWHPV DV ELWXPLQRXV SDYLQJ PL[WXUHV VWUXFWXUDO FRQFUHWH PHWDO IDEULFDWLRQPHWDOFDVWLQJZHOGLQJFRQFUHWHSLSHPDQXIDFWXUHSURWHFWLYHFRDWLQJDSSOLFDWLRQ DQGVLPLODUVKRSRUSODQWRSHUDWLRQV 6WHHO SLSH LQ VL]HV OHVV WKDQ LQFKHV DQG YLWULILHG FOD\ DQG FDVWLURQ SLSH LQ DOO VL]HV DUH DFFHSWDEOHXSRQFHUWLILFDWLRQDVWRFRPSOLDQFHZLWKWKH6SHFLILFDWLRQVVXEMHFWWRVDPSOLQJDQG WHVWLQJ E\ WKH $JHQF\ 6WDQGDUG LWHPV RI HTXLSPHQW VXFK DV HOHFWULF PRWRUV FRQYH\RUV HOHYDWRUVSOXPELQJIL[WXUHVHWFDUHVXEMHFWWRLQVSHFWLRQDWWKHMREVLWHRQO\6SHFLDOLWHPVRI HTXLSPHQWVXFKDVGHVLJQHGHOHFWULFDOSDQHOERDUGVODUJHSXPSVVHZDJHSODQWHTXLSPHQW HWF DUH VXEMHFW WR LQVSHFWLRQ DW WKH VRXUFH QRUPDOO\ RQO\ IRU SHUIRUPDQFH WHVWLQJ 7KH 6SHFLILFDWLRQVPD\UHTXLUHLQVSHFWLRQDWWKHVRXUFHIRURWKHULWHPVQRWW\SLFDORIWKRVHOLVWHGLQ WKLVVHFWLRQ 7KH&RQWUDFWRUVKDOOSURYLGHWKH(QJLQHHUIUHHDQGVDIHDFFHVVWRDQ\DQGDOOSDUWVRIZRUNDW DQ\WLPH6XFKIUHHDQGVDIHDFFHVVVKDOOLQFOXGHPHDQVRIVDIHDFFHVVDQGHJUHVVYHQWLODWLRQ OLJKWLQJVKRULQJGHZDWHULQJDQGDOOHOHPHQWVSHUWDLQLQJWRWKHVDIHW\RISHUVRQVDVFRQWDLQHGLQ Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 5HYLVHG&RQWUDFW1R$3DJHRI WKH6WDWHRI&DOLIRUQLD&DOLIRUQLD&RGHRI5HJXODWLRQV7LWOH,QGXVWULDO5HODWLRQV&KDSWHU 'LYLVLRQRI,QGXVWULDO6DIHW\6XEFKDSWHU&RQVWUXFWLRQ6DIHW\2UGHUVDQGVXFKRWKHUVDIHW\ UHJXODWLRQVDVPD\DSSO\&RQWUDFWRUVKDOOIXUQLVK(QJLQHHUZLWKVXFKLQIRUPDWLRQDVPD\EH QHFHVVDU\WRNHHSWKH(QJLQHHU IXOO\LQIRUPHGUHJDUGLQJSURJUHVVDQGPDQQHURIZRUNDQG FKDUDFWHURIPDWHULDOV,QVSHFWLRQRUWHVWLQJRIWKHZKROHRUDQ\SRUWLRQRIWKHZRUNRUPDWHULDOV LQFRUSRUDWHGLQWKHZRUNVKDOOQRWUHOLHYH&RQWUDFWRUIURPDQ\REOLJDWLRQWRIXOILOOWKLV&RQWUDFW ,QVSHFWLRQ RI 0DWHULDOV 1RW /RFDOO\ 3URGXFHG :KHQ WKH &RQWUDFWRU LQWHQGV WR SXUFKDVHPDWHULDOVIDEULFDWHGSURGXFWVRUHTXLSPHQWIURPVRXUFHVORFDWHGPRUHWKDQPLOHV RXWVLGH WKH JHRJUDSKLFDO OLPLWV RI WKH $JHQF\ DQ LQVSHFWRU RUDFFUHGLWHG WHVWLQJ ODERUDWRU\ DSSURYHGE\WKH(QJLQHHU VKDOOEHHQJDJHGE\WKH&RQWUDFWRUDWLWVH[SHQVHWRLQVSHFWWKH PDWHULDOVHTXLSPHQWRUSURFHVV7KLVDSSURYDOVKDOOEHREWDLQHGEHIRUHSURGXFLQJDQ\PDWHULDO RUHTXLSPHQW7KHLQVSHFWRURUUHSUHVHQWDWLYHRIWKHWHVWLQJODERUDWRU\VKDOOMXGJHWKHPDWHULDOV E\ WKH UHTXLUHPHQWV RI WKH 3ODQV DQG 6SHFLILFDWLRQV 7KH &RQWUDFWRU VKDOO IRUZDUG UHSRUWV UHTXLUHGE\WKH(QJLQHHU1RPDWHULDORUHTXLSPHQWVKDOOEHVKLSSHGQRUVKDOODQ\SURFHVVLQJ IDEULFDWLRQRUWUHDWPHQWRIVXFKPDWHULDOVEHGRQHZLWKRXWSURSHULQVSHFWLRQE\WKHDSSURYHG DJHQW$SSURYDOE\VDLGDJHQWVKDOOQRWUHOLHYHWKH&RQWUDFWRURIUHVSRQVLELOLW\IRUFRPSO\LQJZLWK WKH&RQWUDFWUHTXLUHPHQWV ,QVSHFWLRQ E\ WKH $JHQF\ 7KH $JHQF\ ZLOO SURYLGH DOO LQVSHFWLRQ DQG WHVWLQJ ODERUDWRU\ VHUYLFHV ZLWKLQ PLOHV RI WKH JHRJUDSKLFDO OLPLWVRI WKH $JHQF\ )RU SULYDWH FRQWUDFWVDOOFRVWVRILQVSHFWLRQDWWKHVRXUFHLQFOXGLQJVDODULHVDQGPLOHDJHFRVWVVKDOOEH SDLGE\WKHSHUPLWWHH 7HVWRI0DWHULDO%HIRUHLQFRUSRUDWLRQLQWKH:RUNWKH&RQWUDFWRUVKDOOVXEPLWVDPSOHV RIPDWHULDOVDVWKH(QJLQHHUPD\UHTXLUHDWQRFRVWWRWKH$JHQF\7KH&RQWUDFWRUDWLWV H[SHQVHVKDOOGHOLYHUWKHPDWHULDOVIRUWHVWLQJWRWKHSODFHDQGDWWKHWLPHGHVLJQDWHGE\WKH (QJLQHHU8QOHVVRWKHUZLVHSURYLGHGDOOLQLWLDOWHVWLQJZLOOEHSHUIRUPHGXQGHUWKHGLUHFWLRQRI WKH(QJLQHHUDQGDWQRH[SHQVHWRWKH&RQWUDFWRU,IWKH&RQWUDFWRULVWRSURYLGHDQGSD\IRU WHVWLQJLWZLOOEHVWDWHGLQWKH6SHFLILFDWLRQV)RUSULYDWHFRQWUDFWVWKHWHVWLQJH[SHQVHVKDOOEH ERUQHE\WKHSHUPLWWHH 7KH&RQWUDFWRUVKDOOQRWLI\WKH(QJLQHHULQZULWLQJDWOHDVWGD\VLQDGYDQFHRILWVLQWHQWLRQWR XVHPDWHULDOVIRUZKLFKWHVWVDUHVSHFLILHGWRDOORZVXIILFLHQWWLPHWRSHUIRUPWKHWHVWV7KH QRWLFHVKDOOQDPHWKHSURSRVHGVXSSOLHUDQGVRXUFHRIPDWHULDO ,IWKHQRWLFHRILQWHQWWRXVHLVVHQWEHIRUHWKHPDWHULDOVDUHDYDLODEOHIRUWHVWLQJRULQVSHFWLRQRU LVVHQWVRIDULQDGYDQFHWKDWWKHPDWHULDOVRQKDQGDWWKHWLPHZLOOQRWODVWEXWZLOOEHUHSODFHG E\DQHZORWSULRUWRXVHRQWKH:RUNLWZLOOEHWKH&RQWUDFWRU¶VUHVSRQVLELOLW\WRUHQRWLI\WKH (QJLQHHUZKHQVDPSOHVZKLFKDUHUHSUHVHQWDWLYHPD\EHREWDLQHG ([FHSW DV VSHFLILHG LQ WKHVH 3URYLVLRQV WKH$JHQF\ ZLOO EHDU WKH FRVW RI WHVWLQJ RI ORFDOO\ SURGXFHGPDWHULDOVDQGRURQVLWHZRUNPDQVKLSZKHUHWKHUHVXOWVRIVXFKWHVWVPHHWRUH[FHHG WKH UHTXLUHPHQWV LQGLFDWHG LQ WKH 6WDQGDUG 6SHFLILFDWLRQV 7HFKQLFDO 6SHFLILFDWLRQ DQG DQ\ 6XSSOHPHQWDO3URYLVLRQV7KHFRVWRIDOORWKHUWHVWVVKDOOEHERUQHE\WKH&RQWUDFWRU $WWKHRSWLRQRIWKH(QJLQHHUWKHVRXUFHRIVXSSO\RIHDFKRIWKHPDWHULDOVVKDOOEHDSSURYHGE\ WKH(QJLQHHUEHIRUHWKHGHOLYHU\LVVWDUWHG$OOPDWHULDOVSURSRVHGIRUXVHPD\EHLQVSHFWHGRU WHVWHGDWDQ\WLPHGXULQJWKHLUSUHSDUDWLRQDQGXVH,IDIWHULQFRUSRUDWLQJVXFKPDWHULDOVLQWRWKH :RUN LW LV IRXQG WKDW VRXUFHV RI VXSSO\ WKDW KDYH EHHQ DSSURYHG GR QRW IXUQLVK D XQLIRUP SURGXFWRULIWKHSURGXFWIURPDQ\VRXUFHSURYHVXQDFFHSWDEOHDWDQ\WLPHWKH&RQWUDFWRUVKDOO Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 5HYLVHG&RQWUDFW1R$3DJHRI IXUQLVKDSSURYHGPDWHULDOIURPRWKHUDSSURYHGVRXUFHV,IDQ\SURGXFWSURYHVXQDFFHSWDEOH DIWHULPSURSHUVWRUDJHKDQGOLQJRUIRUDQ\RWKHUUHDVRQLWVKDOOEHUHMHFWHGQRWLQFRUSRUDWHG LQWRWKHZRUNDQGVKDOOEHUHPRYHGIURPWKHSURMHFWVLWHDOODWWKH&RQWUDFWRU¶VH[SHQVH &RPSDFWLRQWHVWVPD\EHPDGHE\WKH(QJLQHHUDQGDOOFRVWVIRUWHVWVWKDWPHHWRUH[FHHGWKH UHTXLUHPHQWVRIWKHVSHFLILFDWLRQVVKDOOEHERUQHE\WKH$JHQF\6DLGWHVWVPD\EHPDGHDWDQ\ SODFHDORQJWKHZRUNDVGHHPHGQHFHVVDU\E\WKH(QJLQHHU7KHFRVWVRIDQ\UHWHVWVPDGH QHFHVVDU\E\QRQFRPSOLDQFHZLWKWKHVSHFLILFDWLRQVVKDOOEHERUQHE\WKH&RQWUDFWRU &HUWLILFDWLRQ 7KH (QJLQHHU PD\ ZDLYH PDWHULDOV WHVWLQJ UHTXLUHPHQWV RI WKH 6SHFLILFDWLRQV DQG DFFHSW WKH PDQXIDFWXUHU¶V ZULWWHQ FHUWLILFDWLRQ WKDW WKH PDWHULDOV WR EH VXSSOLHGPHHWWKRVHUHTXLUHPHQWV0DWHULDOWHVWGDWDPD\EHUHTXLUHGDVSDUWRIWKHFHUWLILFDWLRQ 7UDGH1DPHVRU(TXDOV7KH&RQWUDFWRUPD\VXSSO\DQ\RIWKHPDWHULDOVVSHFLILHGRU RIIHUDQHTXLYDOHQW7KH(QJLQHHUVKDOOGHWHUPLQHZKHWKHUWKHPDWHULDORIIHUHGLVHTXLYDOHQWWR WKDWVSHFLILHG$GHTXDWHWLPHVKDOOEHDOORZHGIRUWKH(QJLQHHUWRPDNHWKLVGHWHUPLQDWLRQ :KHQHYHUDQ\SDUWLFXODUPDWHULDOSURFHVVRUHTXLSPHQWLVLQGLFDWHGE\SDWHQWSURSULHWDU\RU EUDQGQDPHRUE\QDPHRIPDQXIDFWXUHUVXFKZRUGLQJLVXVHGIRUWKHSXUSRVHRIIDFLOLWDWLQJLWV GHVFULSWLRQDQGVKDOOEHGHHPHGWREHIROORZHGE\WKHZRUGV³RUHTXDO´$OLVWLQJRIPDWHULDOVLV QRWLQWHQGHGWREHFRPSUHKHQVLYHRULQRUGHURISUHIHUHQFH7KH&RQWUDFWRUPD\RIIHUDQ\ PDWHULDO SURFHVV RU HTXLSPHQW FRQVLGHUHG WR EH HTXLYDOHQW WRWKDW LQGLFDWHG 7KH VXEVWDQWLDWLRQRIRIIHUVVKDOOEHVXEPLWWHGDVSURYLGHGLQWKH&RQWUDFW'RFXPHQWV 7KH&RQWUDFWRUVKDOODWLWVH[SHQVHIXUQLVKGDWDFRQFHUQLQJLWHPVRIIHUHGE\LWDVHTXLYDOHQWWR WKRVHVSHFLILHG7KH&RQWUDFWRUVKDOOKDYHWKHPDWHULDOWHVWHGDVUHTXLUHGE\WKH(QJLQHHUWR GHWHUPLQHWKDWWKHTXDOLW\VWUHQJWKSK\VLFDOFKHPLFDORURWKHU FKDUDFWHULVWLFV LQFOXGLQJ GXUDELOLW\ILQLVKHIILFLHQF\GLPHQVLRQVVHUYLFHDQGVXLWDELOLW\DUHVXFKWKDWWKHLWHPZLOOIXOILOO LWVLQWHQGHGIXQFWLRQ 7HVWPHWKRGVVKDOOEHVXEMHFWWRWKHDSSURYDORIWKH(QJLQHHU7HVWUHVXOWVVKDOOEHUHSRUWHG SURPSWO\WRWKH(QJLQHHUZKRZLOOHYDOXDWHWKHUHVXOWVDQGGHWHUPLQHLIWKHVXEVWLWXWHLWHPLV HTXLYDOHQW7KH(QJLQHHU¶VILQGLQJVVKDOOEHILQDO,QVWDOODWLRQDQGXVHRIDVXEVWLWXWHLWHPVKDOO QRWEHPDGHXQWLODSSURYHGE\WKH(QJLQHHU ,IDVXEVWLWXWHRIIHUHGE\WKH&RQWUDFWRULVQRWIRXQGWREHHTXDOWRWKHVSHFLILHGPDWHULDOWKH &RQWUDFWRUVKDOOIXUQLVKDQGLQVWDOOWKHVSHFLILHGPDWHULDO 7KHVSHFLILHG&RQWUDFWFRPSOHWLRQWLPHVKDOOQRWEHDIIHFWHGE\DQ\FLUFXPVWDQFHGHYHORSLQJ IURPWKHSURYLVLRQVRIWKLVVHFWLRQ 7KH&RQWUDFWRULVUHVSRQVLEOHIRUWKHVDWLVIDFWRU\SHUIRUPDQFHRIVXEVWLWXWHGLWHPV,ILQWKHVROH RSLQLRQ RI WKH (QJLQHHU WKH VXEVWLWXWLRQ LV GHWHUPLQHG WR EH XQVDWLVIDFWRU\ LQ SHUIRUPDQFH DSSHDUDQFH GXUDELOLW\ FRPSDWLELOLW\ ZLWK DVVRFLDWHG LWHPV DYDLODELOLW\ RI UHSDLU SDUWV DQG VXLWDELOLW\RIDSSOLFDWLRQWKH&RQWUDFWRUVKDOOUHPRYHWKHVXEVWLWXWHGLWHPDQGUHSODFHLWZLWKWKH RULJLQDOO\VSHFLILHGLWHPDWQRFRVWWRWKH$JHQF\ :HLJKLQJ DQG 0HWHULQJ (TXLSPHQW $OO VFDOHV DQG PHWHULQJ HTXLSPHQW XVHG IRU SURSRUWLRQLQJPDWHULDOVVKDOOEHLQVSHFWHGIRUDFFXUDF\DQGFHUWLILHGZLWKLQWKHSDVWPRQWKV E\WKH6WDWHRI&DOLIRUQLD%XUHDXRI:HLJKWVDQG0HDVXUHVE\WKH&RXQW\'LUHFWRURU6HDOHURI :HLJKWVDQG0HDVXUHVRUE\DVFDOHPHFKDQLFUHJLVWHUHGZLWKRUOLFHQVHGE\WKH&RXQW\ Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 5HYLVHG&RQWUDFW1R$3DJHRI 7KHDFFXUDF\RIWKHZRUNRIDVFDOHVHUYLFHDJHQF\H[FHSWDVVWDWHGKHUHLQVKDOOPHHWWKH VWDQGDUGV RI WKH &DOLIRUQLD %XVLQHVV DQG 3URIHVVLRQV &RGH DQG WKH &DOLIRUQLD &RGH RI 5HJXODWLRQVSHUWDLQLQJWRZHLJKLQJGHYLFHV$FHUWLILFDWHRIFRPSOLDQFHVKDOOEHSUHVHQWHGSULRU WR RSHUDWLRQ WR WKH (QJLQHHU IRU DSSURYDO DQG VKDOO EH UHQHZHG ZKHQHYHU UHTXLUHG E\ WKH (QJLQHHUDWQRFRVWWRWKH$JHQF\ $OOVFDOHVVKDOOEHDUUDQJHGVRWKH\PD\EHUHDGHDVLO\IURPWKHRSHUDWRU¶VSODWIRUPRUDUHD 7KH\VKDOOLQGLFDWHWKHWUXHQHWZHLJKWZLWKRXWWKHDSSOLFDWLRQRIDQ\IDFWRU7KHILJXUHVRIWKH VFDOHVVKDOOEHFOHDUO\OHJLEOH6FDOHVVKDOOEHDFFXUDWHWRZLWKLQSHUFHQWZKHQWHVWHGZLWKWKH SODQWVKXWGRZQ:HLJKLQJHTXLSPHQWVKDOOEHVRLQVXODWHGDJDLQVWYLEUDWLRQRUPRYLQJRIRWKHU RSHUDWLQJHTXLSPHQWLQWKHSODQWDUHDWKDWWKHHUURULQZHLJKLQJZLWKWKHHQWLUHSODQWUXQQLQJZLOO QRWH[FHHGSHUFHQWIRUDQ\VHWWLQJQRUSHUFHQWIRUDQ\EDWFK &DOLEUDWLRQ RI 7HVWLQJ (TXLSPHQW7HVWLQJHTXLSPHQWVXFKDVEXWQRWOLPLWHGWR SUHVVXUHJDJHVPHWHULQJGHYLFHVK\GUDXOLFV\VWHPVIRUFH ORDG PHDVXULQJLQVWUXPHQWVDQG VWUDLQPHDVXULQJGHYLFHVVKDOOEHFDOLEUDWHGE\DWHVWLQJDJHQF\DFFHSWDEOHWRWKH(QJLQHHUDW LQWHUYDOV QRW WR H[FHHG PRQWKV DQG IROORZLQJ UHSDLUV PRGLILFDWLRQ RU UHORFDWLRQ RI WKH HTXLSPHQW&DOLEUDWLRQFHUWLILFDWHVVKDOOEHSURYLGHGZKHQUHTXHVWHGE\WKH(QJLQHHU &RQVWUXFWLRQ 0DWHULDOV 'LVSXWH 5HVROXWLRQ 6RLOV 5RFN 0DWHULDOV &RQFUHWH 0RUWDUDQG5HODWHG0DWHULDOV0DVRQU\0DWHULDOV%LWXPLQRXV0DWHULDOV5RFN3URGXFWV DQG0RGLILHG$VSKDOWV ,QWKHLQWHUHVWRIVDIHW\DQGSXEOLFYDOXHZKHQHYHUFUHGLEOHHYLGHQFH DULVHVWRFRQWUDGLFWWKHWHVWYDOXHVRIPDWHULDOVWKH$JHQF\DQGWKH&RQWUDFWRUZLOOLQLWLDWHDQ LPPHGLDWHDQGFRRSHUDWLYHLQYHVWLJDWLRQ7HVWYDOXHVRIPDWHULDOVDUHUHVXOWVRIWKHPDWHULDOV¶ WHVWVDVGHILQHGE\WKHVH6SHFLILFDWLRQVRUE\WKHVSHFLDOSURYLVLRQVUHTXLUHGWRDFFHSWWKH :RUN &UHGLEOH HYLGHQFH LV SURFHVV REVHUYDWLRQV RU WHVW YDOXHVJDWKHUHG XVLQJ LQGXVWU\ DFFHSWHGSUDFWLFHV$FRQWUDGLFWLRQH[LVWVZKHQHYHUWHVWYDOXHVRUSURFHVVREVHUYDWLRQVRIWKH VDPHRUVLPLODUPDWHULDOVDUHGLYHUVHHQRXJKVXFKWKDWWKHZRUNDFFHSWDQFHRUSHUIRUPDQFH EHFRPHV VXVSHFW 7KH LQYHVWLJDWLRQ VKDOO DOORZ DFFHVV WR DOO WHVW UHVXOWV SURFHGXUHV DQG IDFLOLWLHV UHOHYDQW WR WKH GLVSXWHG ZRUN DQG FRQVLGHU DOO DYDLODEOH LQIRUPDWLRQ DQG ZKHQ QHFHVVDU\JDWKHUQHZDQGDGGLWLRQDOLQIRUPDWLRQLQDQDWWHPSWWRGHWHUPLQHWKHYDOLGLW\WKH FDXVH DQG LI QHFHVVDU\ WKH UHPHG\ WR WKH FRQWUDGLFWLRQ ,I WKH FRRSHUDWLYH LQYHVWLJDWLRQ UHDFKHV DQ\ UHVROXWLRQ PHFKDQLVP DFFHSWDEOH WR ERWK WKH $JHQF\DQG WKH &RQWUDFWRU WKH FRQWUDGLFWLRQ VKDOO EH FRQVLGHUHG UHVROYHG DQG WKH FRRSHUDWLYHLQYHVWLJDWLRQ FRQFOXGHG :KHQHYHUWKHFRRSHUDWLYHLQYHVWLJDWLRQLVXQDEOHWRUHDFKUHVROXWLRQWKHLQYHVWLJDWLRQPD\WKHQ HLWKHUFRQFOXGHZLWKRXWUHVROXWLRQRUFRQWLQXHE\ZULWWHQQRWLILFDWLRQRIRQHSDUW\WRWKHRWKHU UHTXHVWLQJWKHLPSOHPHQWDWLRQRIDUHVROXWLRQSURFHVVE\FRPPLWWHH7KHFRQWLQXDQFHRIWKH LQYHVWLJDWLRQVKDOOEHFRQWLQJHQWXSRQUHFLSLHQW¶VDJUHHPHQWDQGDFNQRZOHGJHGLQZULWLQJZLWKLQ FDOHQGDUGD\VDIWHUUHFHLYLQJDUHTXHVW:LWKRXWDFNQRZOHGJHPHQWWKHLQYHVWLJDWLRQVKDOO FRQFOXGHZLWKRXWUHVROXWLRQ7KHFRPPLWWHHVKDOOFRQVLVWRIWKUHH6WDWHRI&DOLIRUQLD5HJLVWHUHG &LYLO(QJLQHHUV:LWKLQFDOHQGDUGD\VDIWHUWKHZULWWHQUHTXHVWQRWLILFDWLRQWKH$JHQF\DQGWKH &RQWUDFWRU ZLOO HDFK VHOHFW RQH HQJLQHHU :LWKLQ FDOHQGDU GD\V RI WKH ZULWWHQ UHTXHVW QRWLILFDWLRQWKHWZRVHOHFWHGHQJLQHHUVZLOOVHOHFWDWKLUGHQJLQHHU7KHJRDOLQVHOHFWLRQRIWKH WKLUGPHPEHULVWRFRPSOHPHQWWKHSURIHVVLRQDOH[SHULHQFHRIWKHILUVWWZRHQJLQHHUV6KRXOG WKHWZRHQJLQHHUVIDLOWRVHOHFWWKHWKLUGHQJLQHHUWKH$JHQF\DQGWKH&RQWUDFWRUVKDOOHDFK SURSRVHHQJLQHHUVWREHWKHWKLUGPHPEHUZLWKLQFDOHQGDUGD\VDIWHUWKHZULWWHQUHTXHVW QRWLILFDWLRQ 7KH ILUVW WZR HQJLQHHUV SUHYLRXVO\ VHOHFWHG VKDOO WKHQ VHOHFW RQH RI WKH IRXU SURSRVHGHQJLQHHUVLQDEOLQGGUDZ7KHFRPPLWWHHVKDOOEHDFRQWLQXDQFHRIWKHFRRSHUDWLYH LQYHVWLJDWLRQ DQG ZLOO UHFRQVLGHUDOO DYDLODEOH LQIRUPDWLRQ DQGLIQHFHVVDU\JDWKHUQHZDQG DGGLWLRQDOLQIRUPDWLRQWRGHWHUPLQHWKHYDOLGLW\WKHFDXVHDQGLIQHFHVVDU\WKHUHPHG\WRWKH FRQWUDGLFWLRQ7KHFRPPLWWHHZLOOIRFXVXSRQWKHSHUIRUPDQFHDGHTXDF\RIWKHPDWHULDO V XVLQJ Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 5HYLVHG&RQWUDFW1R$3DJH RI VWDQGDUGHQJLQHHULQJSULQFLSOHVDQGSUDFWLFHVDQGWRHQVXUHSXEOLFYDOXHWKHFRPPLWWHHPD\ SURYLGHHQJLQHHULQJUHFRPPHQGDWLRQVDVQHFHVVDU\8QOHVVRWKHUZLVHDJUHHGWKHFRPPLWWHH ZLOOKDYHFDOHQGDUGD\VIURPLWVIRUPDWLRQWRFRPSOHWHWKHLUUHYLHZDQGVXEPLWWKHLUILQGLQJV 7KH ILQDO UHVROXWLRQ RI WKH FRPPLWWHH VKDOO EH E\ PDMRULW\ RSLQLRQ LQ ZULWLQJ VWDPSHG DQG VLJQHG 6KRXOG WKH ILQDO UHVROXWLRQ QRW EH XQDQLPRXV WKH GLVVHQWHU PD\ DWWDFK D ZULWWHQ VWDPSHGDQGVLJQHGPLQRULW\RSLQLRQ2QFHVWDUWHGWKHUHVROXWLRQSURFHVVE\FRPPLWWHHVKDOO FRQWLQXHWRIXOOFRQFOXVLRQXQOHVV :LWKLQGD\VRIWKHIRUPDWLRQRIWKHFRPPLWWHHWKH$JHQF\DQGWKH&RQWUDFWRUUHDFKDQ DFFHSWDEOHUHVROXWLRQPHFKDQLVP RU :LWKLQGD\VRIWKHIRUPDWLRQRIWKHFRPPLWWHHWKHLQLWLDWLQJSDUW\ZLWKGUDZVLWVZULWWHQ QRWLILFDWLRQDQGDJUHHVWREHDUDOOLQYHVWLJDWLYHUHODWHGFRVWVWKXVIDULQFXUUHG RU $W DQ\ SRLQW E\ WKH PXWXDO DJUHHPHQW RI WKH $JHQF\ DQG WKH &RQWUDFWRU 8QOHVV RWKHUZLVH DJUHHG WKH &RQWUDFWRU VKDOO EHDU DQG PDLQWDLQ D UHFRUGIRUDOOWKH LQYHVWLJDWLYHFRVWVXQWLOUHVROXWLRQ6KRXOGWKHLQYHVWLJDWLRQGLVFRYHUDVVLJQDEOHFDXVHV IRUWKHFRQWUDGLFWLRQWKHDVVLJQDEOHSDUW\WKH$JHQF\RUWKH&RQWUDFWRUVKDOOEHDUDOO FRVWVDVVRFLDWHGZLWKWKHLQYHVWLJDWLRQ6KRXOGDVVLJQDEOHFDXVHVIRUWKHFRQWUDGLFWLRQ H[WHQGHGWRERWKSDUWLHVWKHLQYHVWLJDWLRQZLOODVVLJQFRVWVFRRSHUDWLYHO\ZLWKHDFKSDUW\ RUZKHQQHFHVVDU\HTXDOO\6KRXOGWKHLQYHVWLJDWLRQVXEVWDQWLDWHDFRQWUDGLFWLRQZLWKRXW DVVLJQDEOHFDXVHWKHLQYHVWLJDWLRQZLOODVVLJQFRVWVFRRSHUDWLYHO\ZLWKHDFKSDUW\RU ZKHQ QHFHVVDU\ HTXDOO\ 6KRXOG WKH LQYHVWLJDWLRQ EH XQDEOH WRVXEVWDQWLDWH D FRQWUDGLFWLRQWKHLQLWLDWRURIWKHLQYHVWLJDWLRQVKDOOEHDUDOOLQYHVWLJDWLYHFRVWV$OOFODLP QRWLILFDWLRQ UHTXLUHPHQWV RI WKH FRQWUDFW SHUWDLQLQJ WR WKH FRQWUDGLFWLRQ VKDOO EH VXVSHQGHGXQWLOWKHLQYHVWLJDWLRQLVFRQFOXGHG 0$7(5,$/675$163257$7,21+$1'/,1*$1'6725$*(7KH&RQWUDFWRUVKDOO RUGHUSXUFKDVHWUDQVSRUWFRRUGLQDWHGHOLYHU\DFFHSWGHOLYHU\FRQILUPWKHTXDQWLW\DQGTXDOLW\ UHFHLYHGSUHSDUHVWRUDJHDUHD V VWRUHKDQGOHSURWHFWPRYHUHORFDWHUHPRYHDQGGLVSRVH H[FHVVRIDOOPDWHULDOVXVHGWRDFFRPSOLVKWKH:RUN0DWHULDOVVKDOOEHGHOLYHUHGWRWKHVLWHRI WKHZRUNRQO\GXULQJZRUNLQJKRXUVDVGHILQHGLQ6HFWLRQDQGVKDOOEHDFFRPSDQLHGE\ ELOOV RI ODGLQJ WKDW VKDOO FOHDUO\ VWDWH IRU HDFK GHOLYHU\ WKH QDPH RI WKH &RQWUDFWRU DV FRQVLJQHHWKHSURMHFWQDPHDQGQXPEHUDGGUHVVRIGHOLYHU\DQGQDPHRIFRQVLJQRUDQGD GHVFULSWLRQ RI WKH PDWHULDO V VKLSSHG 3ULRU WR VWRUDJH RI DQ\ PDWHULDOV ZKLFK KDYH EHHQ VKLSSHGWRRUE\WKH&RQWUDFWRUWRDQ\ORFDWLRQZLWKLQWKH$JHQF\¶VERXQGDULHVWKH&RQWUDFWRU VKDOOSURYLGHWKH(QJLQHHUDFRS\RIOHDVHDJUHHPHQWVIRUHDFKSURSHUW\ZKHUHVXFKPDWHULDOV DUHVWRUHG7KHOHDVHDJUHHPHQWVKDOOFOHDUO\VWDWHWKHWHUPRIWKHOHDVHWKHGHVFULSWLRQRI PDWHULDOVDOORZHGWREHVWRUHGDQGVKDOOSURYLGHIRUWKHUHPRYDORIWKHPDWHULDOVDQGUHVWRUDWLRQ RIWKHVWRUDJHVLWHZLWKLQWKHWLPHDOORZHGIRUWKH:RUN$OOVXFKVWRUDJHVKDOOFRQIRUPWRDOO ODZVDQGRUGLQDQFHVWKDWPD\SHUWDLQWRWKHPDWHULDOVVWRUHGDQGWRSUHSDUDWLRQRIWKHVWRUDJH VLWH DQG WKH ORFDWLRQ RI WKH VLWH RQ ZKLFK WKH PDWHULDOV DUH VWRUHG /RVV GDPDJH RU GHWHULRUDWLRQRIDOOVWRUHGPDWHULDOVVKDOOEHWKH&RQWUDFWRU¶VUHVSRQVLELOLW\&RQIRUPDQFHWRWKH UHTXLUHPHQWVRIWKLVVHFWLRQERWKZLWKLQDQGRXWVLGHWKHOLPLWVRIZRUNDUHDSDUWRIWKH:RUN 7KH(QJLQHHUVKDOOKDYHWKHULJKWWRYHULI\WKHVXLWDELOLW\RIPDWHULDOVDQGWKHLUSURSHUVWRUDJHDW DQ\WLPHGXULQJWKH:RUN Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 5HYLVHG&RQWUDFW1R$3DJHRI 6(&7,21±87,/,7,(6 /2&$7,21 7KH$JHQF\ DQG DIIHFWHG XWLOLW\ FRPSDQLHV KDYH E\ D VHDUFK RINQRZQ UHFRUGVHQGHDYRUHGWRORFDWHDQGLQGLFDWHRQWKH3ODQVDOOXWLOLWLHVZKLFKDUHNQRZQWRH[LVW ZLWKLQWKHOLPLWVRIWKHZRUN+RZHYHUWKHDFFXUDF\DQGRUFRPSOHWHQHVVRIWKHQDWXUHVL]H DQGRUORFDWLRQRIXWLOLWLHVLQGLFDWHGRQWKH3ODQVLVQRWJXDUDQWHHG :KHUH XQGHUJURXQG PDLQ GLVWULEXWLRQ FRQGXLWV VXFK DV ZDWHU JDV VHZHU HOHFWULF SRZHU WHOHSKRQHRUFDEOHWHOHYLVLRQDUHVKRZQRQWKH3ODQVWKH&RQWUDFWRUVKDOODVVXPHWKDWHYHU\ SURSHUW\SDUFHOZLOOEHVHUYHGE\DVHUYLFHFRQQHFWLRQIRUHDFKW\SHRIXWLOLW\ $VSURYLGHGLQ6HFWLRQRIWKH&DOLIRUQLD*RYHUQPHQW&RGHDWOHDVWZRUNLQJGD\VSULRUWR FRPPHQFLQJ DQ\ H[FDYDWLRQ WKH &RQWUDFWRU VKDOO FRQWDFW WKH UHJLRQDO QRWLILFDWLRQ FHQWHU 8QGHUJURXQG6HUYLFH$OHUWRI6RXWKHUQ&DOLIRUQLD DQGREWDLQDQLQTXLU\LGHQWLILFDWLRQQXPEHU 7KH &DOLIRUQLD 'HSDUWPHQW RI 7UDQVSRUWDWLRQ LV QRW UHTXLUHG E\6HFWLRQ WR EHFRPH D PHPEHU RIWKHUHJLRQDO QRWLILFDWLRQ FHQWHU 7KH &RQWUDFWRU VKDOO FRQWDFW LW IRU ORFDWLRQ RI LWV VXEVXUIDFHLQVWDOODWLRQV 3ULRUWRSLSHOLQHH[FDYDWLRQWKH&RQWUDFWRUVKDOOYHULI\WKHILQGLQJVRIWKHUHSRUWDQGDOOORFDWLRQV DQGGHSWKVRIXWLOLWLHVZKLFKDUHVKRZQE\WKH&RQWUDFW'RFXPHQWVRUKDYHEHHQPDUNHGE\WKH XWLOLW\ RZQHUV ZLWKLQ WKH SURSRVHG WUHQFK ]RQH 7KH &RQWUDFWRUVKDOO SRWKROH DOO VHUYLFH FRQQHFWLRQV XWLOLWLHV WKDW FURVV RU SDUDOOHO ZLWKLQ IHHW WKH SURSRVHGFRQVWUXFWLRQ DQG DOO FRQQHFWLRQ SRLQWV WR H[LVWLQJ XWLOLWLHV 7KH &RQWUDFWRU VKDOO UHFRUG WKH PDWHULDO VL]H RXWVLGH GLDPHWHU W\SHDQGKRUL]RQWDODQGYHUWLFDOORFDWLRQV EHDULQJDQGVORSH DQGVXEPLWWKHGDWD DQGDOORZWLPHIRUWKH(QJLQHHU¶VUHYLHZLQDFFRUGDQFHZLWK6HFWLRQ 7KH&RQWUDFWRUVKDOOYHULI\WKHXWLOLW\OD\RXWSHUWKLV6HFWLRQ)XOOFRPSHQVDWLRQIRUVXFKZRUN VKDOOEHFRQVLGHUHGLQFOXGHGLQWKHELGLWHPRIZRUNUHTXLULQJWKHSRWKROLQJDQGQRVHSDUDWH SD\PHQWVKDOOEHPDGHWKHUHIRU 3527(&7,21 7KH &RQWUDFWRU VKDOO QRW LQWHUUXSW WKH VHUYLFH IXQFWLRQ RU GLVWXUE WKH VXSSRUWRIDQ\XWLOLW\ZLWKRXWDXWKRULW\IURPWKHRZQHURURUGHUIURPWKH$JHQF\$OOYDOYHV VZLWFKHVYDXOWVDQGPHWHUVVKDOOEHPDLQWDLQHGUHDGLO\DFFHVVLEOHIRUHPHUJHQF\VKXWRII :KHUHSURWHFWLRQLVUHTXLUHGWRHQVXUHVXSSRUWRIXWLOLWLHVORFDWHGDVVKRZQRQWKH3ODQVRULQ DFFRUGDQFHZLWK6HFWLRQWKH&RQWUDFWRUVKDOOXQOHVVRWKHUZLVHSURYLGHGIXUQLVKDQGSODFH WKHQHFHVVDU\SURWHFWLRQDWLWVH[SHQVH 8SRQOHDUQLQJRIWKHH[LVWHQFHDQGORFDWLRQRIDQ\XWLOLW\RPLWWHGIURPRUVKRZQLQFRUUHFWO\RQ WKH3ODQVWKH&RQWUDFWRUVKDOOLPPHGLDWHO\QRWLI\WKH(QJLQHHULQZULWLQJ:KHQDXWKRUL]HGE\ WKH(QJLQHHUVXSSRUWRUSURWHFWLRQRIWKHXWLOLW\ZLOOEHSDLGIRUDVSURYLGHGLQ6HFWLRQRU 7KH &RQWUDFWRU VKDOO LPPHGLDWHO\QRWLI\ WKH (QJLQHHU DQG WKH XWLOLW\ RZQHU LI DQ\ XWLOLW\ LV GLVWXUEHGRUGDPDJHG7KH&RQWUDFWRUVKDOOEHDUWKHFRVWVRIUHSDLURUUHSODFHPHQWRIDQ\XWLOLW\ GDPDJHGLIORFDWHGDVQRWHGLQ6HFWLRQ :KHQ SODFLQJ FRQFUHWH DURXQG RU FRQWLJXRXV WR DQ\ QRQPHWDOOLFXWLOLW\ LQVWDOODWLRQ WKH &RQWUDFWRUVKDOODWLWVH[SHQVH Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 5HYLVHG&RQWUDFW1R$3DJHRI )XUQLVKDQGLQVWDOODLQFKFXVKLRQRIH[SDQVLRQMRLQWPDWHULDORURWKHUVLPLODUUHVLOLHQW PDWHULDO RU 3URYLGHDVOHHYHRURWKHURSHQLQJZKLFKZLOOUHVXOWLQDLQFKPLQLPXPFOHDUDQQXODU VSDFHEHWZHHQWKHFRQFUHWHDQGWKHXWLOLW\ RU 3URYLGHRWKHUDFFHSWDEOHPHDQVWRSUHYHQWHPEHGPHQWLQRUERQGLQJWRWKHFRQFUHWH :KHUHFRQFUHWHLVXVHGIRUEDFNILOORUIRUVWUXFWXUHVZKLFKZRXOGUHVXOWLQHPEHGPHQWRUSDUWLDO HPEHGPHQWRIDPHWDOOLFXWLOLW\LQVWDOODWLRQ RUZKHUHWKHFRDWLQJEHGGLQJRURWKHUFDWKRGLF SURWHFWLRQV\VWHPLVH[SRVHGRUGDPDJHGE\WKH&RQWUDFWRU¶VRSHUDWLRQVWKH&RQWUDFWRUVKDOO QRWLI\WKH(QJLQHHUDQGDUUDQJHWRVHFXUHWKHDGYLFHRIWKHDIIHFWHGXWLOLW\RZQHUUHJDUGLQJWKH SURFHGXUHVUHTXLUHGWRPDLQWDLQRUUHVWRUHWKHLQWHJULW\RIWKHV\VWHP 5(029$/8QOHVV RWKHUZLVH VSHFLILHG WKH &RQWUDFWRU VKDOO UHPRYH DOO LQWHUIHULQJ SRUWLRQVRIXWLOLWLHVVKRZQRQWKH3ODQVRULQGLFDWHGLQWKH%LGGRFXPHQWVDV³DEDQGRQHG´RU³WR EHDEDQGRQHGLQSODFH´%HIRUHVWDUWLQJUHPRYDORSHUDWLRQVWKH&RQWUDFWRUVKDOODVFHUWDLQIURP WKH$JHQF\ZKHWKHUWKHDEDQGRQPHQWLVFRPSOHWHDQGWKHFRVWVLQYROYHGLQWKHUHPRYDODQG GLVSRVDOVKDOOEHLQFOXGHGLQWKH%LGIRUWKHLWHPVRIZRUNQHFHVVLWDWLQJVXFKUHPRYDOV 7KHFRVWVLQYROYHGLQWKHUHPRYDODQGGLVSRVDOVKDOOEHFRQVLGHUHGLQFLGHQWDOWRWKHELGLWHPVRI ZRUNQHFHVVLWDWLQJVXFKUHPRYDOVDQGQRVHSDUDWHSD\PHQWVKDOOEHPDGHWKHUHIRUXQOHVVD ELGLWHPIRU³5HPRYDO´LVVSHFLILFDOO\LQFOXGHGLQWKHELGSURSRVDO 5(/2&$7,21 :KHQ IHDVLEOH WKH RZQHUV UHVSRQVLEOH IRU XWLOLWLHV ZLWKLQ WKHDUHD DIIHFWHG E\ WKH :RUN ZLOO FRPSOHWH WKHLU QHFHVVDU\ LQVWDOODWLRQV UHORFDWLRQV UHSDLUV RU UHSODFHPHQWV EHIRUH FRPPHQFHPHQW RI ZRUN E\ WKH &RQWUDFWRU :KHQ WKH 3ODQV RU 6SHFLILFDWLRQV LQGLFDWHWKDW D XWLOLW\ LQVWDOODWLRQ LV WR EH UHORFDWHGDOWHUHGRUFRQVWUXFWHGE\ RWKHUVWKH$JHQF\ZLOOFRQGXFWDOOQHJRWLDWLRQVZLWKWKHRZQHUVDQGZRUNZLOOEHGRQHDWQRFRVW WRWKH&RQWUDFWRUH[FHSWIRUPDQKROHIUDPHDQGFRYHUVHWVWREHEURXJKWWRJUDGHDVGLUHFWHG DQGDSSURYHGE\WKH&LW\8WLOLWLHVZKLFKDUHUHORFDWHGLQRUGHUWRDYRLGLQWHUIHUHQFHVKDOOEH SURWHFWHGLQWKHLUSRVLWLRQDQGWKHFRVWRIVXFKSURWHFWLRQVKDOOEHLQFOXGHGLQWKH%LGIRUWKH LWHPVRIZRUNQHFHVVLWDWLQJVXFKUHORFDWLRQ $IWHUDZDUGRIWKH&RQWUDFWSRUWLRQVRIXWLOLWLHVZKLFKDUHIRXQGWRLQWHUIHUHZLWKWKH:RUNZLOOEH UHORFDWHGDOWHUHGRUUHFRQVWUXFWHGE\WKHRZQHUVRUWKH(QJLQHHUPD\RUGHUFKDQJHVLQWKH :RUNWRDYRLGLQWHUIHUHQFH6XFKFKDQJHVZLOOEHSDLGIRULQDFFRUGDQFHZLWK6HFWLRQ :KHQWKH3ODQVRU6SHFLILFDWLRQVSURYLGHIRUWKH&RQWUDFWRUWRDOWHUUHORFDWHRUUHFRQVWUXFWD XWLOLW\DOOFRVWVIRUVXFKZRUNVKDOOEHLQFOXGHGLQWKH%LGIRUWKHLWHPVRIZRUNQHFHVVLWDWLQJ VXFK ZRUN 7HPSRUDU\ RU SHUPDQHQW UHORFDWLRQ RU DOWHUDWLRQ RI XWLOLWLHV UHTXHVWHG E\ WKH &RQWUDFWRUIRULWVFRQYHQLHQFHVKDOOEHLWVUHVSRQVLELOLW\DQGLWVKDOOPDNHDOODUUDQJHPHQWVDQG EHDUDOOFRVWV 7KHXWLOLW\RZQHUZLOOUHORFDWHVHUYLFHFRQQHFWLRQVDVQHFHVVDU\ZLWKLQWKHOLPLWVRIWKH:RUNRU ZLWKLQ WHPSRUDU\ FRQVWUXFWLRQ RU VORSH HDVHPHQWV :KHQ GLUHFWHG E\ WKH (QJLQHHU WKH &RQWUDFWRUVKDOODUUDQJHIRUWKHUHORFDWLRQRIVHUYLFHFRQQHFWLRQVDVQHFHVVDU\EHWZHHQWKH PHWHUDQGSURSHUW\OLQHRUEHWZHHQDPHWHUDQGWKHOLPLWVRIWHPSRUDU\FRQVWUXFWLRQRUVORSH HDVHPHQWV 7KH UHORFDWLRQ RI VXFK VHUYLFH FRQQHFWLRQV ZLOO EH SDLG IRU LQ DFFRUGDQFH ZLWK SURYLVLRQV RI 6HFWLRQ 3D\PHQW ZLOO LQFOXGH WKH UHVWRUDWLRQ RI DOO H[LVWLQJ LPSURYHPHQWV ZKLFK PD\ EH DIIHFWHG WKHUHE\ 7KH &RQWUDFWRU PD\ DJUHH ZLWK WKH RZQHU RI DQ\ XWLOLW\ WR GLVFRQQHFWDQGUHFRQQHFWLQWHUIHULQJVHUYLFHFRQQHFWLRQV7KH$JHQF\ZLOOQRWEHLQYROYHGLQ DQ\VXFKDJUHHPHQW Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 5HYLVHG&RQWUDFW1R$3DJHRI ,QFRQIRUPDQFHZLWK6HFWLRQWKH&RQWUDFWRUVKDOOFRRUGLQDWHWKHZRUNZLWKXWLOLW\DJHQFLHV DQGFRPSDQLHV3ULRUWRWKHLQVWDOODWLRQRIDQ\DQGDOOXWLOLW\VWUXFWXUHVZLWKLQWKHOLPLWVRIZRUN E\DQ\XWLOLW\DJHQF\RUFRPSDQ\RULWVFRQWUDFWRUWKH&RQWUDFWRUVKDOOSODFHDOOFXUERUFXUE DQGJXWWHUWKDWLVDSDUWRIWKHZRUNDQGDGMDFHQWWRWKHORFDWLRQZKHUHVXFKXWLOLW\VWUXFWXUHVDUH VKRZQ RQ WKH SODQV DQG DUH QRWHG DV EHLQJ ORFDWHG UHORFDWHG RU DUH RWKHUZLVH VKRZQ DV LQVWDOOHGE\RWKHUV,QRUGHUWRPLQLPL]HGHOD\VWRWKH&RQWUDFWRUFDXVHGE\WKHIDLOXUHRIRWKHU SDUWLHV WR UHORFDWH XWLOLWLHV WKDW LQWHUIHUH ZLWK WKH FRQVWUXFWLRQ WKH &RQWUDFWRU XSRQ WKH (QJLQHHU¶VDSSURYDOPD\EHSHUPLWWHGWRWHPSRUDULO\RPLWWKHSRUWLRQRIZRUNDIIHFWHGE\WKH XWLOLW\,IVXFKWHPSRUDU\RPLVVLRQLVDSSURYHGE\WKH(QJLQHHUWKH&RQWUDFWRUVKDOOSODFHVXUYH\ RU RWKHU SK\VLFDO FRQWURO PDUNHUV VXIILFLHQW WR ORFDWH WKH FXUERUFXUEDQGJXWWHUWRWKH VDWLVIDFWLRQ RI WKH XWLOLW\ DJHQF\ RU FRPSDQ\ 6XFK WHPSRUDU\ RPLVVLRQ VKDOO EH IRU WKH &RQWUDFWRU¶V FRQYHQLHQFH DQG QR DGGLWLRQDO FRPSHQVDWLRQ ZLOO EH DOORZHG WKHUHIRUH RU IRU DGGLWLRQDOZRUNPDWHULDOVRUGHOD\DVVRFLDWHGZLWKWKHWHPSRUDU\RPLVVLRQ7KHSRUWLRQWKXV RPLWWHGVKDOOEHFRQVWUXFWHGE\WKH&RQWUDFWRULPPHGLDWHO\IROORZLQJWKHUHORFDWLRQRIWKHXWLOLW\ LQYROYHGXQOHVVRWKHUZLVHGLUHFWHGE\WKH(QJLQHHU '(/$<67KH&RQWUDFWRUVKDOOQRWLI\WKH(QJLQHHURILWVFRQVWUXFWLRQVFKHGXOHLQVRIDUDV LWDIIHFWVWKHSURWHFWLRQUHPRYDORUUHORFDWLRQRIXWLOLWLHV6DLGQRWLILFDWLRQVKDOOEHLQFOXGHGDVD SDUW RI WKH FRQVWUXFWLRQ VFKHGXOH UHTXLUHG LQ 6HFWLRQ 7KH&RQWUDFWRU VKDOO QRWLI\ WKH (QJLQHHULQZULWLQJRIDQ\VXEVHTXHQWFKDQJHVLQWKHFRQVWUXFWLRQVFKHGXOHZKLFKZLOODIIHFWWKH WLPHDYDLODEOHIRUSURWHFWLRQUHPRYDORUUHORFDWLRQRIXWLOLWLHV 7KH&RQWUDFWRUZLOOQRWEHHQWLWOHGWRGDPDJHVRUDGGLWLRQDOSD\PHQWIRUGHOD\VDWWULEXWDEOHWR XWLOLW\UHORFDWLRQVRUDOWHUDWLRQVLIFRUUHFWO\ORFDWHGQRWHGDQGFRPSOHWHGLQDFFRUGDQFHZLWK 6HFWLRQ 7KH &RQWUDFWRU PD\ EH JLYHQ DQ H[WHQVLRQ RI WLPH IRU XQIRUHVHHQ GHOD\V DWWULEXWDEOH WR XQUHDVRQDEO\ SURWUDFWHG LQWHUIHUHQFH E\ XWLOLWLHV LQ SHUIRUPLQJZRUNFRUUHFWO\VKRZQRQWKH 3ODQV 7KH$JHQF\ZLOODVVXPHUHVSRQVLELOLW\IRUWKHWLPHO\UHPRYDOUHORFDWLRQRUSURWHFWLRQRIH[LVWLQJ PDLQRUWUXQNOLQHXWLOLW\IDFLOLWLHVZLWKLQWKHDUHDDIIHFWHGE\WKH:RUNLIVXFKXWLOLWLHVDUHQRW LGHQWLILHGLQWKH&RQWUDFW'RFXPHQWV7KH&RQWUDFWRUZLOOQRWEHDVVHVVHGOLTXLGDWHGGDPDJHV IRU DQ\ GHOD\ FDXVHG E\ IDLOXUH RI $JHQF\ WR SURYLGH IRU WKH WLPHO\ UHPRYDO UHORFDWLRQ RU SURWHFWLRQRIVXFKH[LVWLQJIDFLOLWLHV ,I WKH &RQWUDFWRU VXVWDLQV ORVV GXH WR GHOD\V DWWULEXWDEOH WR LQWHUIHUHQFHV UHORFDWLRQV RU DOWHUDWLRQVQRWFRYHUHGE\6HFWLRQZKLFKFRXOGQRWKDYHEHHQDYRLGHGE\WKHMXGLFLRXV KDQGOLQJRIIRUFHVHTXLSPHQWRUSODQWWKHUHVKDOOEHSDLGWRWKH&RQWUDFWRUVXFKDPRXQWDVWKH (QJLQHHUPD\ILQGWREHIDLUDQGUHDVRQDEOHFRPSHQVDWLRQIRUVXFKSDUWRIWKH&RQWUDFWRU¶V DFWXDOORVVDVZDVXQDYRLGDEOHDQGWKH&RQWUDFWRUPD\EHJUDQWHGDQH[WHQVLRQRIWLPH &223(5$7,21:KHQQHFHVVDU\WKH&RQWUDFWRUVKDOOVRFRQGXFWLWVRSHUDWLRQVDVWR SHUPLWDFFHVVWRWKH:RUNVLWHDQGSURYLGHWLPHIRUXWLOLW\ZRUNWREHDFFRPSOLVKHGGXULQJWKH SURJUHVV RI WKH :RUN &RRSHUDWLRQ ZLWK &0:' DQG &LW\ VWDII ZLOOEHUHTXLUHGIRUDOOZRUN DIIHFWLQJH[LVWLQJXWLOLW\V\VWHPVRUIDFLOLWLHVDQG SULRUWRZDWHUXWLOLW\VKXWGRZQVWHVWLQJDQG LQVSHFWLRQVDQGSURMHFWFRPSOHWLRQ Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 5HYLVHG&RQWUDFW1R$3DJHRI 6(&7,21±3526(&87,21352*5(66 $1'$&&(37$1&(2)7+(:25. &216758&7,21 6&+('8/( $1' &200(1&(0(17 2) :25. ([FHSW DV RWKHUZLVHSURYLGHGKHUHLQDQGXQOHVVRWKHUZLVHSURKLELWHGE\SHUPLWVIURPRWKHUDJHQFLHVDV PD\EHUHTXLUHGE\ODZWKH&RQWUDFWRUVKDOOEHJLQZRUNZLWKLQWHQ FDOHQGDUGD\VDIWHU UHFHLSWRIWKH1RWLFHWR3URFHHG 3UH&RQVWUXFWLRQ0HHWLQJ$IWHURUXSRQQRWLILFDWLRQRIFRQWUDFWDZDUGWKH(QJLQHHU ZLOOVHWWKHWLPHDQGORFDWLRQIRUWKH3UHFRQVWUXFWLRQ0HHWLQJ$WWHQGDQFHRIWKH&RQWUDFWRU¶V PDQDJHPHQWSHUVRQQHOUHVSRQVLEOHIRUWKHPDQDJHPHQWDGPLQLVWUDWLRQDQGH[HFXWLRQRIWKH SURMHFWLVPDQGDWRU\IRUWKHPHHWLQJWREHFRQYHQHG)DLOXUH RIWKH&RQWUDFWRUWRKDYHWKH &RQWUDFWRU¶VUHVSRQVLEOHSURMHFWSHUVRQQHODWWHQGWKH3UHFRQVWUXFWLRQ0HHWLQJZLOOEHJURXQGV IRUGHIDXOWE\&RQWUDFWRUSHU6HFWLRQ1RVHSDUDWHSD\PHQWZLOOEHPDGHIRUWKH&RQWUDFWRU¶V DWWHQGDQFHDWWKHPHHWLQJ7KHQRWLFHWRSURFHHGZLOORQO\EHLVVXHGRQRUDIWHUWKHFRPSOHWLRQ RIWKHSUHFRQVWUXFWLRQPHHWLQJ %DVHOLQH &RQVWUXFWLRQ 6FKHGXOH 7KH &RQWUDFWRU VKDOO SUHSDUH WKH %DVHOLQH &RQVWUXFWLRQ6FKHGXOHDVD&ULWLFDO3DWK0HWKRG &30 6FKHGXOHLQWKHSUHFHGHQFHGLDJUDP PHWKRG DFWLYLW\RQQRGH IRUPDW DQG VXEPLW WKH VFKHGXOH LQ DFFRUGDQFH ZLWK 7KH VFKHGXOHVKDOO $ %H SUHSDUHG XVLQJ D FRPPHUFLDOO\ DYDLODEOH :LQGRZV FRPSDWLEOH VRIWZDUH SURJUDP ³6XUHWUDN´E\3ULPDYHUDRU³3URMHFW´E\0LFURVRIW&RUSRUDWLRQRUDSSURYHGHTXDO % %HSUHSDUHGLQKDUGFRS\ SDSHU DQGHOHFWURQLF $GREH3') IRUPDWDQGIUHHRIILOH ORFNLQJHQFU\SWLRQRUDQ\RWKHUSURWRFROWKDWZRXOGLPSHGHIXOODFFHVVWRWKHGDWDDQG ODEHOHG ZLWK WKH SURMHFW QDPH DQG QXPEHU WKH &RQWUDFWRU¶V QDPH DQG WKH GDWH RI SUHSDUDWLRQ & %HJLQZLWKWKHGDWHSURMHFWHGIRUWKH1RWLFHWR3URFHHGDQGFRQFOXGHZLWKWKHGDWHRI ILQDOFRPSOHWLRQFRQIRUPLQJZLWKWKH&RQWUDFWWLPH ' 'HSLFW D WLPHVFDOHG QHWZRUNGLDJUDP RI DOO DFWLYLWLHV ORJLF UHODWLRQVKLSV RI LQWHUGHSHQGHQWDFWLYLWLHVDQGPLOHVWRQHVFRPSULVLQJWKHFRPSOHWHSHULRGRI:RUNZLWK WDVNV RQ WKH YHUWLFDO D[LV DQG WKHLU GXUDWLRQV RQ WKH KRUL]RQWDO D[LV 8VH GLVWLQFWLYH WH[WXUHSDWWHUQVRUOLQHW\SHVWRVKRZWKHFULWLFDOSDWKZLWKLQWKH&RQWUDFWWLPH,QFOXGHD WDEXODUOLVWLQJRIHDFKDFWLYLW\DQGLWVLGHQWLILFDWLRQQXPEHUGHVFULSWLRQGXUDWLRQHDUO\ VWDUWHDUO\ILQLVKODWHVWDUWODWHILQLVKWRWDOIORDWDQGDOOSUHGHFHVVRUDQGVXFFHVVRU DFWLYLWLHV 7KH QXPEHURI DFWLYLWLHV ZLOO FRPPXQLFDWHWKH &RQWUDFWRU¶VSODQIRUSURMHFW H[HFXWLRQDFFXUDWHO\GHVFULEHWKHSURMHFWZRUNDQGDOORZPRQLWRULQJDQGHYDOXDWLRQRI SURJUHVVDQGWLPHLPSDFWV$FWLYLW\GHVFULSWLRQVVKDOODFFXUDWHO\GHILQHWKHZRUNSODQQHG IRUWKHDFWLYLW\$FWLYLW\GXUDWLRQVVKDOOQRWEHVKRUWHUWKDQZRUNLQJGD\RUORQJHUWKDQ ZRUNLQJGD\VXQOHVVDSSURYHGE\WKH(QJLQHHU ( ,QFOXGH GHWDLO RI DOO SURMHFW SKDVLQJ VWDJLQJ DQG VHTXHQFLQJ LQFOXGLQJ DOO PLOHVWRQHV QHFHVVDU\WRGHILQHEHJLQQLQJDQGHQGLQJRIHDFKSKDVHRUVWDJHDQGFRQVWUDLQWVZKLFK PD\LPSDFWDQ\DFWLYLW\,QFOXGHWLPHDOORZDQFHVIRUFRRUGLQDWLRQZLWKXWLOLW\FRPSDQLHV DQGRWKHUDJHQFLHVHTXLSPHQWDQGPDWHULDOGHOLYHULHVVXEPLWWDOUHYLHZVDQGDSSURYDOV Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 5HYLVHG&RQWUDFW1R$3DJHRI WUDIILFFRQWUROVHWXSDQGSKDVLQJ:RUNSHUIRUPHGE\RWKHUVLQVSHFWLRQVWHVWLQJDQG FRPPLVVLRQLQJFRUUHFWLYHZRUNDQGDQ\QRQZRUNSHULRGV )ORDWRUVODFNWLPHZLWKLQWKHVFKHGXOHLVDYDLODEOHZLWKRXWFKDUJHRUFRPSHQVDWLRQWRZKDWHYHU SDUW\RUFRQWLQJHQF\ILUVWH[KDXVWVLW$VFKHGXOHZKLFKVKRZVDSURMHFWGXUDWLRQORQJHUWKDQWKH &RQWUDFW7LPHZLOOQRWEHDFFHSWDEOHDQGZLOOEHJURXQGVWRFRQVLGHUWKH&RQWUDFWRULQGHIDXOWRI WKH&RQWUDFWSHU 7KH(QJLQHHUPD\FKRRVHWRDFFHSWWKH&RQWUDFWRU¶VSURSRVDORIDSURMHFWGXUDWLRQZKLFKLV VKRUWHU WKDQ WKH &RQWUDFW WLPH SURYLGHG WKH VKRUWHQHG %DVHOLQH&RQVWUXFWLRQ 6FKHGXOH LV UHDVRQDEOHDQGGHPRQVWUDWHVWRWKHVDWLVIDFWLRQRIWKH(QJLQHHUWKDWWKH$JHQF\DQGDOORWKHU HQWLWLHVSXEOLFDQGSULYDWHZKLFKLQWHUIDFHZLWKWKHSURMHFWDUHDEOHWRVXSSRUWWKHSURYLVLRQVRI WKH VKRUWHQHGVFKHGXOH $FFHSWDQFH RI D VKRUWHQHG %DVHOLQH &RQVWUXFWLRQ 6FKHGXOH ZLOO EH FRQILUPHGWKURXJKWKHH[HFXWLRQRID&KDQJH2UGHUUHYLVLQJWKH&RQWUDFWWLPH 7KH (QJLQHHU¶V DSSURYDO RI WKH %DVHOLQH &RQVWUXFWLRQ 6FKHGXOH LV DFRQGLWLRQ SUHFHGHQW WR LVVXDQFHRIWKH1RWLFHWR3URFHHG,IWKHVFKHGXOHGRHVQRWPHHWWKHUHTXLUHPHQWVRIWKHVH VSHFLILFDWLRQVWKH&RQWUDFWRUVKDOOUHYLVHWKHVFKHGXOHDQGUHVXEPLWLWWRWKH(QJLQHHU)DLOXUH WRREWDLQWKH(QJLQHHU¶VDSSURYDORIWKHVFKHGXOHZLWKLQILIWHHQ ZRUNLQJGD\VDIWHUWKHGDWH RIWKHSUHFRQVWUXFWLRQPHHWLQJVKDOOEHJURXQGV WRFRQVLGHUWKH&RQWUDFWRULQGHIDXOWRIWKH &RQWUDFWSHU7KHQXPEHURIZRUNLQJGD\VXVHGE\WKH(QJLQHHU WR UHYLHZ WKH LQLWLDO %DVHOLQH &RQVWUXFWLRQ 6FKHGXOH VXEPLWWDO ZLOO QRW EH LQFOXGHG LQ WKH ZRUNLQJ GD\V 7KH (QJLQHHU VKDOO FRPSOHWH VXEVHTXHQW UHYLHZV RI WKH UHYLVHG VFKHGXOH DQG SURJUHVV XSGDWHV ZLWKLQZRUNLQJGD\VRIUHFHLSW7KH(QJLQHHU¶VUHVSRQVHWRHDFKUHYLHZZLOOFRQVLVWRIRQHRI WKHIROORZLQJ ³$FFHSWHG´7KH&RQWUDFWRUPD\SURFHHGZLWKWKH:RUNXSRQLVVXDQFHRIWKH 1RWLFH WR 3URFHHG 3D\PHQW IRU WKH VFKHGXOH PD\ EH UHTXHVWHG E\WKH &RQWUDFWRU ³$FFHSWHGZLWK&RPPHQWV´7KH&RQWUDFWRUPD\SURFHHGZLWKWKH:RUNXSRQ LVVXDQFHRIWKH1RWLFHWR3URFHHG7KH&RQWUDFWRUPXVWUHYLVHDQGUHVXEPLWWKH VFKHGXOHDQGUHFHLYHWKH(QJLQHHU¶VDFFHSWDQFHRIWKHVFKHGXOHEHIRUHSD\PHQW IRUWKHVFKHGXOHLVUHTXHVWHGE\WKH&RQWUDFWRU ³1RW$FFHSWHG´7KH&RQWUDFWRUPD\QRWSURFHHGZLWKWKH:RUNPXVWUHYLVHDQG UHVXEPLWWKHVFKHGXOHDQGPD\QRWUHTXHVWSD\PHQWIRUWKHVFKHGXOH 6FKHGXOH8SGDWHVDQG5HYLVLRQV7KH&RQWUDFWRUVKDOOPHHWZLWKWKH(QJLQHHUGXULQJ WKHODVWZHHNRIHDFKPRQWKWRDJUHHXSRQWKHFRPSOHWLRQOHYHORIHDFKDFWLYLW\DVDEDVLVIRU SURJUHVV SD\PHQWV 6FKHGXOH XSGDWHV VKDOO FRQIRUP ZLWK WKH UHTXLUHPHQWV IRU WKH LQLWLDO VXEPLWWDOLQDQGVKDOO $ 6KRZWKHDFWXDOGDWHVRIHDFKDFWLYLW\VWDUWDQGRUILQLVKGXULQJWKHPRQWK7KHVFKHGXOH XSGDWHVKDOOLQFOXGHVSHFLILFQRWDWLRQIRUDQ\FKDQJHVLQDFWXDOGDWHVDIWHUWKH\DUHILUVW UHSRUWHG % 5HSRUWWKHSHUFHQWFRPSOHWHIRUHDFKDFWLYLW\LQSURJUHVVDWWKHHQGRIWKHPRQWKDV GHWHUPLQHGE\WKH(QJLQHHU Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 5HYLVHG&RQWUDFW1R$3DJHRI & ,QFOXGH D OLVW DQG H[SODQDWLRQ RI DOO FKDQJHV PDGH WR WKH DFWLYLWLHV GDWHV RU LQWHUFRQQHFWLQJORJLF ' ,QFOXGH DFWLYLW\ DQG QHWZRUN UHYLVLRQV UHIOHFWLQJ WKH &KDQJH 2UGHUV DSSURYHG LQ WKH SUHYLRXV PRQWK DV DJUHHG XSRQ GXULQJ WKH UHYLHZ DQG DFFHSWDQFHRI WKH &KDQJH 2UGHUV 7KH(QJLQHHU¶VUHVSRQVHVWRWKHSURJUHVVVFKHGXOHXSGDWHVVKDOOEHDVGHVFULEHGLQ 7KH &RQWUDFWRU VKDOO SURFHHG ZLWK :RUN DQG UHTXHVW SD\PHQW IRUWKH SURJUHVV VFKHGXOH XSGDWHVDVGHVFULEHGWKHUHLQ ,I WKH &RQWUDFWRU IDLOV WR VXEPLW WKH SURJUHVV VFKHGXOH XSGDWHV DV UHTXLUHG KHUHLQ WKH &RQWUDFWRUPD\HOHFWWRSURFHHGZLWKWKH:RUNDWLWVRZQULVNDQGVKDOOIRUIHLWSD\PHQWIRUWKH SURJUHVVVFKHGXOHXSGDWHXQWLOFRPSOLDQFHLVPHW,IWKH&RQWUDFWRUHOHFWVWRGHOD\RUFHDVH :RUN DIWHU IDLOXUH WR VXEPLW WKH SURJUHVV VFKHGXOH XSGDWHV DQ\ UHVXOWLQJ GHOD\ LPSDFW RU GLVUXSWLRQWRWKH:RUNZLOOEHWKH&RQWUDFWRU¶VUHVSRQVLELOLW\ ,QWHULP 5HYLVLRQV 6KRXOG WKH DFWXDO RU SURMHFWHG SURJUHVV RI WKH :RUN H[FHHG SHUFHQW RI WKH &RQWUDFW 7LPH WKH &RQWUDFWRU VKDOO SUHSDUH DQGVXEPLW D UHYLVHG %DVHOLQH &RQVWUXFWLRQ6FKHGXOHLQGHSHQGHQWO\RIDQGSULRUWRWKHQH[WSURJUHVVVFKHGXOHXSGDWHZLWKD OLVWDQGH[SODQDWLRQRIHDFKFKDQJHPDGHWRWKHVFKHGXOH7KHVXEPLWWDOVFKHGXOHUHYLHZDQG DFFHSWDQFHUHTXLUHPHQWVRIVKDOODSSO\ /DWH&RPSOHWLRQRU0LOHVWRQH'DWHV,IDVFKHGXOHXSGDWHLQGLFDWHVDFRPSOHWLRQGDWH ODWHUWKDQWKH&RQWUDFWWLPHRUFRQWUDFWXDOO\UHTXLUHGPLOHVWRQHFRPSOHWLRQGDWHWKH$JHQF\ PD\ZLWKKROG/LTXLGDWHG'DPDJHVIRUWKHQXPEHURIGD\VODWH6KRXOGDVXEVHTXHQWVFKHGXOH XSGDWHZKLFKUHPRYHVDOORUDSRUWLRQRIWKHGHOD\EH³$FFHSWHG´E\WKH(QJLQHHUDOORUWKH DOORFDWHGSRUWLRQRIWKHSUHYLRXVO\KHOG/LTXLGDWHG'DPDJHVVKDOOEHUHOHDVHGLQWKHPRQWKO\ SD\PHQWWRWKH&RQWUDFWRULPPHGLDWHO\IROORZLQJVXFKDFFHSWDQFH )LQDO 6FKHGXOH 8SGDWH 7KH &RQWUDFWRU VKDOO SUHSDUH DQG VXEPLW D ILQDO VFKHGXOH XSGDWH ZKHQ RQH KXQGUHG SHUFHQWRI WKH :RUN LV FRPSOHWHG 7KH XSGDWH PXVW DFFXUDWHO\ UHSUHVHQWWKHDFWXDOGDWHVIRUDOODFWLYLWLHV7KHILQDOVFKHGXOHXSGDWHVKDOOEHSUHSDUHGDQG UHYLHZHGLQDFFRUGDQFHZLWK$FFHSWDQFHRIWKHILQDOVFKHGXOHXSGDWHLVUHTXLUHGIRU UHOHDVHRIIXQGVUHWDLQHGSHU 7KUHH:HHN/RRN$KHDG6FKHGXOHV7KH&RQWUDFWRUVKDOOVXEPLWDGHWDLOHGZHHN ORRNDKHDGVFKHGXOHSULRUWRHDFKSURJUHVVPHHWLQJWKURXJKRXWSURMHFWGXUDWLRQ7KHVFKHGXOHV VKDOOEHUHYLVHGZHHNO\WRLGHQWLI\WKHFRQVWUXFWLRQDFWLYLWLHVDQGGXUDWLRQVIRUHDFKELGLWHPRI ZRUN IRU WKH FXUUHQW ZHHN DQG WKH VXFFHHGLQJ WZR ZHHNV 7KH &RQWUDFWRU VKDOO UHYLVH WKH VFKHGXOHWRLQFOXGHDGGLWLRQDODFWLYLWLHVRUDFWXDOSURJUHVVZKHQVRUHTXHVWHGE\WKH(QJLQHHU 0HDVXUHPHQWDQG3D\PHQW7KH&RQWUDFWRU¶VSUHSDUDWLRQUHYLVLRQDQGPDLQWHQDQFH RIWKH&RQVWUXFWLRQ6FKHGXOHDUHLQFLGHQWDOWRWKH:RUNDQGQRVHSDUDWHSD\PHQWZLOOEHPDGH WKHUHIRU 3526(&87,212):25.7RPLQLPL]HSXEOLFLQFRQYHQLHQFHDQGSRVVLEOHKD]DUGDQG WRUHVWRUHVWUHHWDQGRWKHUZRUNDUHDVWRWKHLURULJLQDOFRQGLWLRQDQGVWDWHRIXVHIXOQHVVDVVRRQ DVSUDFWLFDEOHWKH&RQWUDFWRUVKDOOGLOLJHQWO\SURVHFXWHWKH:RUNWRFRPSOHWLRQ,IWKH(QJLQHHU GHWHUPLQHV WKDW WKH &RQWUDFWRU LV IDLOLQJ WR SURVHFXWH WKH :RUN WR WKH SURSHU H[WHQW WKH &RQWUDFWRUVKDOOXSRQRUGHUVIURPWKH(QJLQHHULPPHGLDWHO\WDNHVWHSVWRUHPHG\WKHVLWXDWLRQ Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 5HYLVHG&RQWUDFW1R$3DJHRI $OOFRVWVRISURVHFXWLQJWKH:RUNDVGHVFULEHGKHUHLQVKDOOEHLQFOXGHGLQWKH&RQWUDFWRU¶V%LG 6KRXOGWKH&RQWUDFWRUIDLOWRWDNHWKHQHFHVVDU\VWHSVWRIXOO\DFFRPSOLVKVDLGSXUSRVHVDIWHU RUGHUVRIWKH(QJLQHHUWKH(QJLQHHUPD\VXVSHQGWKHZRUNLQZKROHRUSDUWXQWLOWKH&RQWUDFWRU WDNHVVDLGVWHSV $VVRRQDVSRVVLEOHXQGHUWKHSURYLVLRQVRIWKH6SHFLILFDWLRQVWKH&RQWUDFWRUVKDOOEDFNILOODOO H[FDYDWLRQVDQGUHVWRUHWRXVHIXOQHVVDOOLPSURYHPHQWVH[LVWLQJSULRUWRWKHVWDUWRIWKH:RUN ,I:RUNLVVXVSHQGHGWKURXJKQRIDXOWRIWKH$JHQF\DOOH[SHQVHVDQGORVVHVLQFXUUHGE\WKH &RQWUDFWRUGXULQJVXFKVXVSHQVLRQVVKDOOEHERUQHE\WKH&RQWUDFWRU,IWKH&RQWUDFWRUIDLOVWR SURSHUO\ SURYLGH IRU SXEOLF VDIHW\ WUDIILF DQG SURWHFWLRQ RIWKH :RUN GXULQJ SHULRGV RI VXVSHQVLRQWKH$JHQF\PD\HOHFWWRGRVRDQGGHGXFWWKHFRVWWKHUHRIIURPPRQLHVGXHWKH &RQWUDFWRU6XFKDFWLRQVZLOOQRWUHOLHYHWKH&RQWUDFWRUIURPOLDELOLW\ 7KH&RQWUDFWRUVKDOOLQFRUSRUDWHQRQZRUNGD\VPRUDWRULXPVRUVSHFLDOHYHQWVVSHFLILHGLQWKH &RQWUDFW 'RFXPHQWV LQWR WKH &RQVWUXFWLRQ 6FKHGXOH UHTXLUHG E\ 6HFWLRQ 1R DGGLWLRQDO SD\PHQW DGMXVWPHQW RI ELG SULFHV RU DGMXVWPHQWV RI FRQWUDFW WLPH ZLOO EH DOORZHG DV D FRQVHTXHQFHRIWKHVHHYHQWV 2UGHURI:RUN7KHZRUNWREHGRQHVKDOOFRQVLVWRIIXUQLVKLQJDOOODERUHTXLSPHQWDQG PDWHULDOVDQGSHUIRUPLQJDOORSHUDWLRQVQHFHVVDU\WRFRPSOHWHWKH:RUNDVVKRZQRUVSHFLILHG RQWKH&RQWUDFW'RFXPHQWV7KHZRUNGHVFULSWLRQVLQWKLVVHFWLRQDUHDQRYHUYLHZRQO\DQGVKDOO QRWUHOLHYHWKH&RQWUDFWRUIURPLWVUHVSRQVLELOLWLHVWRFRQGXFWDOOFRRUGLQDWLRQDQGSHUIRUPWKH :RUNLQDFFRUGDQFHZLWKWKH&RQWUDFW'RFXPHQWV &RQVWUXFWLRQ3KDVLQJ7KHIROORZLQJFRQVWUXFWLRQSKDVHJXLGHOLQHVDUHSURYLGHGIRUWKH &RQWUDFWRU¶VXVHLQGHYHORSLQJWKHFRQVWUXFWLRQVFKHGXOHDQGD:RUN3ODQWKDWGHVFULEHVWKH ODERUPDWHULDOVHTXLSPHQWDQGSURFHGXUHVWRFRQGXFWWKH:RUN7KHSKDVLQJJXLGHOLQHVOLVWHG KHUHLQDUHQRWLQWHQGHGWREHDFRPSOHWHOLVWRIDOOFRQVWUXFWLRQDFWLYLWLHVDQGVKDOOQRWUHOLHYHWKH &RQWUDFWRU IURP LWV UHVSRQVLELOLWLHV WR FRRUGLQDWH DQG SHUIRUPWKH :RUN UHYLVH WKH SKDVLQJ GHVFULSWLRQVRUWRGHYHORSDGGLWLRQDOSKDVHVRUUHYLVHWKHRUGHURISKDVLQJDVQHFHVVDU\WR FRPSOHWHWKH:RUNLQLWVHQWLUHW\LQDFFRUGDQFHZLWKWKH&RQWUDFW'RFXPHQWV 7KH:RUNVKDOORFFXUFRQVHFXWLYHO\DWHDFKIDFLOLW\LQWKHIROORZLQJRUGHU L (OP LL 6N\OLQH 7KH&RQWUDFWRUVKDOOFRPSOHWHDOOZRUNDWWKH(OP5HVHUYRLUZLWKWKHIDFLOLW\UHWXUQHGWR VHUYLFHSULRUWRSURFHHGLQJWRWKH6N\OLQH5HVHUYRLU 7KHFRQWUDFWRUVKDOOVXEPLWDQ(6KXWGRZQUHTXHVW$SSHQGL[&WRWKHHQJLQHHUDW OHDVWWZRZHHNVSULRUWRWKHUHTXHVWHGVKXWGRZQGDWH&0:'RSHUDWLRQVZLOOLVRODWHDQG GHZDWHUWKHWDQNXSRQWKLVUHTXHVW 3URMHFW0HHWLQJV7KH(QJLQHHUZLOOHVWDEOLVKWKHWLPHDQGORFDWLRQRIZHHNO\3URMHFW 0HHWLQJV 7KH &RQWUDFWRU¶V 5HSUHVHQWDWLYH VKDOO DWWHQG HDFK 3URMHFW 0HHWLQJ 7KH 3URMHFW 5HSUHVHQWDWLYH VKDOO EH WKH LQGLYLGXDO GHWHUPLQHG XQGHU 6HFWLRQ ³7KH &RQWUDFWRU¶V 5HSUHVHQWDWLYH´ 1R VHSDUDWH SD\PHQW IRU DWWHQGDQFH RI WKH &RQWUDFWRU WKH &RQWUDFWRU¶V 5HSUHVHQWDWLYHRUDQ\RWKHUHPSOR\HHRUVXEFRQWUDFWRURUVXEFRQWUDFWRU¶VHPSOR\HHDWWKHVH PHHWLQJVZLOOEHPDGH Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 5HYLVHG&RQWUDFW1R$3DJHRI 6863(16,212):25. *HQHUDO 7KH:RUNPD\EHVXVSHQGHGLQZKROHRU LQSDUWZKHQGHWHUPLQHGE\WKH (QJLQHHUWKDWWKHVXVSHQVLRQLVQHFHVVDU\LQWKHLQWHUHVWRIWKH$JHQF\7KH&RQWUDFWRUVKDOO FRPSO\LPPHGLDWHO\ZLWKDQ\ZULWWHQRUGHURIWKH(QJLQHHU6XFKVXVSHQVLRQVKDOOEHZLWKRXW OLDELOLW\WRWKH&RQWUDFWRURQWKHSDUWRIWKH$JHQF\H[FHSWDVRWKHUZLVHVSHFLILHGLQ6HFWLRQ $UFKDHRORJLFDO DQG 3DOHRQWRORJLFDO 'LVFRYHULHV 7KH &RQWUDFWRU VKDOO FRRUGLQDWH ZLWKWKH$UFKDHRORJLFDODQG&XOWXUDO0RQLWRUGXULQJH[FDYDWLRQDFWLYLWLHV ,IGLVFRYHU\LVPDGHRILWHPVRIDUFKDHRORJLFDORUSDOHRQWRORJLFDOLQWHUHVWWKH&RQWUDFWRUVKDOO LPPHGLDWHO\FHDVHH[FDYDWLRQLQWKHDUHDRIGLVFRYHU\DQGVKDOOQRWFRQWLQXHXQWLORUGHUHGE\ WKH(QJLQHHU:KHQUHVXPHGH[FDYDWLRQRSHUDWLRQVZLWKLQWKHDUHDRIGLVFRYHU\VKDOOEHDV GLUHFWHGE\WKH(QJLQHHU 'LVFRYHULHVZKLFKPD\EHHQFRXQWHUHGPD\LQFOXGHEXWQRWEHOLPLWHGWRGZHOOLQJVLWHVVWRQH LPSOHPHQWVRURWKHUDUWLIDFWVDQLPDOERQHVKXPDQERQHVDQGIRVVLOV 7KH&RQWUDFWRUVKDOOEHHQWLWOHGWRDQH[WHQVLRQDQGFRPSHQVDWLRQLQDFFRUGDQFHZLWK6HFWLRQ '()$8/7%<&2175$&725,IWKH&RQWUDFWRUIDLOVWRSURPSWO\EHJLQSURFXUHPHQWRU GHOLYHU\RIPDWHULDODQGHTXLSPHQWWRFRPPHQFHWKH:RUNZLWKLQWKHWLPHVSHFLILHGWRPDLQWDLQ WKHUDWHRIGHOLYHU\RIPDWHULDOWRH[HFXWHWKH:RUNLQWKHPDQQHUDQGDWVXFKORFDWLRQVDV VSHFLILHGRUIDLOVWRPDLQWDLQWKH:RUNVFKHGXOHZKLFKZLOOLQVXUHWKH$JHQF\¶VLQWHUHVWRULIWKH &RQWUDFWRULVQRWFDUU\LQJRXWWKHLQWHQWRIWKH&RQWUDFWWKH$JHQF\PD\VHUYHZULWWHQQRWLFH XSRQWKH&RQWUDFWRUDQGWKH6XUHW\RQLWV)DLWKIXO3HUIRUPDQFH%RQGGHPDQGLQJVDWLVIDFWRU\ FRPSOLDQFHZLWKWKH&RQWUDFW 7KH&RQWUDFWPD\EHFDQFHOHGE\WKH%RDUGZLWKRXWOLDELOLW\IRUGDPDJHZKHQLQWKH%RDUG¶V RSLQLRQWKH&RQWUDFWRULVQRWFRPSO\LQJLQJRRGIDLWKKDVEHFRPHLQVROYHQWRUKDVDVVLJQHGRU VXEFRQWUDFWHG DQ\ SDUW RI WKH :RUN ZLWKRXW WKH %RDUG¶V FRQVHQW ,Q WKH HYHQW RI VXFK FDQFHOODWLRQWKH&RQWUDFWRUZLOOEHSDLGWKHDFWXDODPRXQWGXHEDVHGRQ&RQWUDFW8QLW3ULFHVRU OXPSVXPVELGDQGWKHTXDQWLW\RIWKH:RUNFRPSOHWHGDWWKHWLPHRIFDQFHOODWLRQOHVVGDPDJHV FDXVHGWRWKH$JHQF\E\DFWVRIWKH&RQWUDFWRU7KH&RQWUDFWRU LQKDYLQJ WHQGHUHG D %LG VKDOOEHGHHPHGWRKDYHZDLYHGDQ\DQGDOOFODLPVIRUGDPDJHVEHFDXVHRIFDQFHOODWLRQRI &RQWUDFWIRUDQ\VXFKUHDVRQ,IWKH$JHQF\GHFODUHVWKH&RQWUDFWFDQFHOHGIRUDQ\RIWKHDERYH UHDVRQVZULWWHQQRWLFHWRWKDWHIIHFWVKDOOEHVHUYHGXSRQWKH6XUHW\7KH6XUHW\VKDOOZLWKLQ ILYH GD\VDVVXPHFRQWURODQGSHUIRUPWKH:RUNDVVXFFHVVRUWRWKH&RQWUDFWRU ,IWKH6XUHW\DVVXPHVDQ\SDUWRIWKH:RUNLWVKDOOWDNHWKH&RQWUDFWRU¶VSODFHLQDOOUHVSHFWVIRU WKDWSDUWDQGVKDOOEHSDLGE\WKH$JHQF\IRUDOOZRUNSHUIRUPHGE\LWLQDFFRUGDQFHZLWKWKH &RQWUDFW,IWKH6XUHW\DVVXPHVWKHHQWLUH&RQWUDFWDOOPRQH\GXHWKH&RQWUDFWRUDWWKHWLPHRI LWVGHIDXOWVKDOOEHSD\DEOHWRWKH6XUHW\DVWKH:RUNSURJUHVVHVVXEMHFWWRWKHWHUPVRIWKH &RQWUDFW ,IWKH6XUHW\GRHVQRWDVVXPHFRQWURODQGSHUIRUPWKH:RUNZLWKLQGD\VDIWHUUHFHLYLQJQRWLFH RIFDQFHOODWLRQRUIDLOVWRFRQWLQXHWRFRPSO\WKH$JHQF\PD\H[FOXGHWKH6XUHW\IURPWKH SUHPLVHV7KH$JHQF\PD\WKHQWDNHSRVVHVVLRQRIDOOPDWHULDODQGHTXLSPHQWDQGFRPSOHWH WKH :RUN E\ $JHQF\ IRUFHV E\ OHWWLQJ WKH XQILQLVKHG :RUN WR DQRWKHU &RQWUDFWRU RU E\ D Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 5HYLVHG&RQWUDFW1R$3DJHRI FRPELQDWLRQRIVXFKPHWKRGV,QDQ\HYHQWWKHFRVWRIFRPSOHWLQJWKH:RUNVKDOOEHFKDUJHG DJDLQVWWKH&RQWUDFWRUDQGLWV6XUHW\DQGPD\EHGHGXFWHGIURPDQ\PRQH\GXHRUEHFRPLQJ GXHIURPWKH$JHQF\,IWKHVXPVGXHXQGHUWKH&RQWUDFWDUHLQVXIILFLHQWIRUFRPSOHWLRQWKH &RQWUDFWRURU6XUHW\VKDOOSD\WRWKH$JHQF\ZLWKLQGD\VDIWHUWKHFRPSOHWLRQDOOFRVWVLQ H[FHVVRIWKHVXPVGXH 7KHSURYLVLRQVRIWKLVVHFWLRQVKDOOEHLQDGGLWLRQWRDOORWKHUULJKWVDQGUHPHGLHVDYDLODEOHWRWKH $JHQF\XQGHUODZ 7(50,1$7,21 2) &2175$&7 7KH %RDUG PD\ WHUPLQDWH WKH &RQWUDFW DW LWV RZQ GLVFUHWLRQRUZKHQFRQGLWLRQVHQFRXQWHUHGGXULQJWKH:RUNPDNHLWLPSRVVLEOHRULPSUDFWLFDEOH WRSURFHHGRUZKHQWKH$JHQF\LVSUHYHQWHGIURPSURFHHGLQJZLWKWKH&RQWUDFWE\DFWRI*RG E\ODZRUE\RIILFLDODFWLRQRIDSXEOLFDXWKRULW\ '(/$<6$1'(;7(16,2162)7,0( *HQHUDO ,I GHOD\V DUH FDXVHG E\ XQIRUHVHHQ HYHQWV EH\RQG WKH FRQWURO RI WKH &RQWUDFWRUVXFKGHOD\VZLOOHQWLWOHWKH&RQWUDFWRUWRDQH[WHQVLRQRIWLPHDVSURYLGHGKHUHLQEXW WKH&RQWUDFWRUZLOOQRWEHHQWLWOHGWRGDPDJHVRUDGGLWLRQDOSD\PHQWGXHWRVXFKGHOD\VH[FHSW DVSURYLGHGLQ6XFKXQIRUHVHHQHYHQWVPD\LQFOXGHZDUJRYHUQPHQWUHJXODWLRQVODERU GLVSXWHVVWULNHVILUHVIORRGVDGYHUVHZHDWKHURUHOHPHQWVQHFHVVLWDWLQJFHVVDWLRQRIZRUN LQDELOLW\WRREWDLQPDWHULDOVODERURUHTXLSPHQWUHTXLUHGH[WUDZRUNRURWKHUVSHFLILFHYHQWVDV PD\EHIXUWKHUGHVFULEHGLQWKH6SHFLILFDWLRQV 1RH[WHQVLRQRIWLPHZLOOEHJUDQWHGIRUDGHOD\FDXVHGE\WKH&RQWUDFWRU¶VLQDELOLW\WRREWDLQ PDWHULDOVXQOHVVWKH&RQWUDFWRUIXUQLVKHVWRWKH(QJLQHHUGRFXPHQWDU\SURRI7KHSURRIPXVWEH SURYLGHGLQDWLPHO\PDQQHULQDFFRUGDQFHZLWKWKHVHTXHQFHRIWKH&RQWUDFWRU¶VRSHUDWLRQVDQG WKHDSSURYHGFRQVWUXFWLRQVFKHGXOH ,IGHOD\VEH\RQGWKH&RQWUDFWRU¶VFRQWURODUHFDXVHGE\HYHQWVRWKHUWKDQWKRVHPHQWLRQHG DERYHWKH(QJLQHHUPD\GHHPDQH[WHQVLRQRIWLPHWREHLQWKHEHVWLQWHUHVWRIWKH$JHQF\ 7KH&RQWUDFWRUZLOOQRWEHHQWLWOHGWRGDPDJHVRUDGGLWLRQDOSD\PHQWGXHWRVXFKGHOD\VH[FHSW DVSURYLGHGLQ6HFWLRQ ,IGHOD\VEH\RQGWKH&RQWUDFWRU¶VFRQWURODUHFDXVHGVROHO\E\DFWLRQRULQDFWLRQE\WKH$JHQF\ VXFKGHOD\VZLOOHQWLWOHWKH&RQWUDFWRUWRDQH[WHQVLRQRIWLPHDVSURYLGHGLQ6HFWLRQ ([WHQVLRQVRI7LPH([WHQVLRQVRIWLPHZKHQJUDQWHGZLOOEHEDVHGXSRQWKHHIIHFWRI GHOD\VWRWKH:RUN7KH\ZLOOQRWEHJUDQWHGIRUQRQFRQWUROOLQJGHOD\VWRPLQRUSRUWLRQVRIWKH :RUNXQOHVVLWFDQEHVKRZQWKDWVXFKGHOD\VGLGRUZLOOGHOD\WKHSURJUHVVRIWKH:RUN 3D\PHQWIRU'HOD\VWR&RQWUDFWRU7KH&RQWUDFWRUZLOOEHFRPSHQVDWHGIRUGDPDJHV LQFXUUHGGXHWRGHOD\VIRUZKLFKWKH$JHQF\LVUHVSRQVLEOH6XFKDFWXDOFRVWVZLOOEHGHWHUPLQHG E\WKH(QJLQHHU7KH$JHQF\ZLOOQRWEHOLDEOHIRUGDPDJHVZKLFKWKH&RQWUDFWRUFRXOGKDYH DYRLGHGE\DQ\UHDVRQDEOHPHDQVVXFKDVMXGLFLRXVKDQGOLQJRIIRUFHVHTXLSPHQWRUSODQW 7KHGHWHUPLQDWLRQRIZKDWGDPDJHVWKH&RQWUDFWRUFRXOGKDYHDYRLGHGZLOOEHPDGHE\WKH (QJLQHHU :ULWWHQ1RWLFHDQG5HSRUW7KH&RQWUDFWRUVKDOOSURYLGHZULWWHQQRWLFHWRWKH(QJLQHHU ZLWKLQWZRKRXUVRIWKHEHJLQQLQJRIDQ\SHULRGWKDWWKH&RQWUDFWRUKDVSODFHGDQ\ZRUNHUVRU HTXLSPHQWRQVWDQGE\IRUDQ\UHDVRQWKDWWKH&RQWUDFWRUKDVGHWHUPLQHGWREHFDXVHGE\WKH Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 5HYLVHG&RQWUDFW1R$3DJH RI $JHQF\RUE\DQ\RUJDQL]DWLRQWKDWWKH$JHQF\PD\RWKHUZLVHEHREOLJDWHGE\7KH&RQWUDFWRU VKDOOSURYLGHFRQWLQXLQJGDLO\ZULWWHQQRWLFHWRWKH(QJLQHHUHDFKZRUNLQJGD\WKURXJKRXWWKH GXUDWLRQ RI VXFK SHULRG RI GHOD\ 7KH LQLWLDO DQG FRQWLQXLQJ ZULWWHQ QRWLFHV VKDOO LQFOXGH WKH FODVVLILFDWLRQ RI HDFK ZRUNPDQ DQG VXSHUYLVRU DQG WKH PDNH DQGPRGHO RI HDFK SLHFH RI HTXLSPHQWSODFHGRQVWDQGE\WKHFXPXODWLYHGXUDWLRQRIWKHVWDQGE\WKH&RQWUDFWRU¶VRSLQLRQ RIWKHFDXVHRIWKHGHOD\DQGDFRJHQWH[SODQDWLRQRIZK\WKH&RQWUDFWRUFRXOGQRWDYRLGWKH GHOD\E\UHDVRQDEOHPHDQV6KRXOGWKH&RQWUDFWRUIDLOWRSURYLGHWKHQRWLFH V UHTXLUHGE\WKLV VHFWLRQWKH&RQWUDFWRUDJUHHVWKDWQRGHOD\KDVRFFXUUHGDQGWKDWLWZLOOQRWVXEPLWDQ\FODLP V WKHUHIRUH 7,0(2)&203/(7,21 *HQHUDO 7KH &RQWUDFWRU VKDOO FRPSOHWH WKH :RUN ZLWKLQ WKH WLPH VHW IRUWK LQ WKH &RQWUDFW7KH&RQWUDFWRUVKDOOFRPSOHWHHDFKSRUWLRQRIWKH:RUNZLWKLQVXFKWLPHDVVHWIRUWKLQ WKH&RQWUDFWIRUVXFKSRUWLRQ7KHWLPHRIFRPSOHWLRQRIWKH&RQWUDFWVKDOOEHH[SUHVVHGLQ ZRUNLQJGD\V7KH&RQWUDFWRUVKDOOGLOLJHQWO\SURVHFXWHWKHZRUNWRFRPSOHWLRQZLWKLQ RQH KXQGUHGVL[W\ ZRUNLQJGD\VDIWHUWKHVWDUWLQJGDWHVSHFLILHGLQWKH1RWLFHWR3URFHHG :RUNLQJ 'D\ $ ZRUNLQJ GD\ LV DQ\ GD\ ZLWKLQ WKH SHULRG EHWZHHQ WKH VWDUW RI WKH &RQWUDFWWLPHDVGHILQHGLQ6HFWLRQDQGWKHGDWHSURYLGHGIRUFRPSOHWLRQRUXSRQILHOG DFFHSWDQFHE\WKH(QJLQHHUIRUDOOZRUNSURYLGHGIRULQWKH&RQWUDFWZKLFKHYHURFFXUVILUVW RWKHUWKDQ 6DWXUGD\ 6XQGD\ DQ\GD\GHVLJQDWHGDVDKROLGD\E\WKH$JHQF\ DQ\GD\LGHQWLILHGDVDFRQVWUXFWLRQPRUDWRULXPGXHWRVSHFLDOHYHQWVRUKROLGD\SHULRGV DQ\RWKHUGD\GHVLJQDWHGDVDKROLGD\LQD0DVWHU/DERU$JUHHPHQWHQWHUHGLQWRE\WKH &RQWUDFWRU RU RQ EHKDOI RI WKH &RQWUDFWRU DV DQ HOLJLEOH PHPEHU RI D FRQWUDFWRU DVVRFLDWLRQ DQ\GD\WKH&RQWUDFWRULVSUHYHQWHGIURPZRUNLQJDWWKHEHJLQQLQJRIWKHZRUNGD\IRU FDXVHDVGHILQHGLQ6HFWLRQ DQ\GD\WKH&RQWUDFWRULVSUHYHQWHGIURPZRUNLQJGXULQJWKHILUVWKRXUVZLWKDWOHDVW SHUFHQWRIWKHQRUPDOZRUNIRUFHIRUFDXVHDVGHILQHGLQ6HFWLRQ 8QOHVVRWKHUZLVHVSHFLILHGRUDSSURYHGLQZULWLQJE\WKH(QJLQHHUWKHKRXUVRIZRUNVKDOOEH EHWZHHQWKHKRXUVRIDPDQGSPRQ0RQGD\VWKURXJK)ULGD\VH[FOXGLQJ$JHQF\ KROLGD\VDQGRWKHUUHVWULFWHGGD\VRUWLPHVDVVSHFLILHGLQWKH&RQWUDFW'RFXPHQWV 7KH&RQWUDFWRUVKDOOREWDLQWKHZULWWHQDSSURYDORIWKH(QJLQHHULIWKH&RQWUDFWRUGHVLUHVWRZRUN RXWVLGHVDLGKRXUVRUDWDQ\WLPHGXULQJZHHNHQGVDQGRUKROLGD\V7KLVZULWWHQSHUPLVVLRQ PXVWEHREWDLQHGDWOHDVWKRXUVSULRUWRVXFKZRUN7KH(QJLQHHUPD\DSSURYHZRUNRXWVLGH WKHKRXUVDQGRUGD\VVWDWHGKHUHLQZKHQLQKLVKHUVROHRSLQLRQVXFKZRUNFRQGXFWHGE\WKH &RQWUDFWRU LV EHQHILFLDO WR WKH EHVW LQWHUHVWV RI WKH $JHQF\ 7KH &RQWUDFWRU VKDOO SD\ WKH LQVSHFWLRQFRVWVRIVXFKZRUN 7KH&RQWUDFWRUVKDOOLQFRUSRUDWHWKHGDWHVDUHDVDQGW\SHVRIZRUNSURKLELWHGHOVHZKHUHLQWKH &RQWUDFW'RFXPHQWVLQWRWKHFRQVWUXFWLRQVFKHGXOH1RDGGLWLRQDOSD\PHQWDGMXVWPHQWRIELG SULFHVRUDGMXVWPHQWRIFRQWUDFWWLPHRIFRPSOHWLRQZLOOEHDOORZHGDVDFRQVHTXHQFHRIWKH SURKLELWLRQRIZRUNEHLQJSHUIRUPHGZLWKLQWKHGDWHVDUHDVDQGRUW\SHVRIZRUNSURKLELWHGLQ WKLVVHFWLRQ Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 5HYLVHG&RQWUDFW1R$3DJH RI &RQWUDFWRULVKHUHE\DGYLVHGWKDWWKH(QJLQHHUPD\UHTXLUHDIWHU KRXUV RU ZHHNHQG ZRUN LI UHTXLUHGIRUWKHSURWHFWLRQDQGVDIHW\RIH[LVWLQJIDFLOLWLHVZRUNHUVRUWKHSXEOLF &RQWUDFW 7LPH $FFRXQWLQJ 7KH (QJLQHHU ZLOO PDNH D GDLO\ GHWHUPLQDWLRQ RI HDFK ZRUNLQJGD\WREHFKDUJHGDJDLQVWWKH&RQWUDFWWLPH7KHVHGHWHUPLQDWLRQVZLOOEHGLVFXVVHG DQGWKH&RQWUDFWRUZLOOEHIXUQLVKHGDSHULRGLFVWDWHPHQWVKRZLQJDOORZDEOHQXPEHURIZRUNLQJ GD\VRI&RQWUDFWWLPHDVDGMXVWHGDWWKHEHJLQQLQJRIWKHUHSRUWLQJSHULRG7KHVWDWHPHQWZLOO DOVRLQGLFDWHWKHQXPEHURIZRUNLQJGD\VFKDUJHGGXULQJWKHUHSRUWLQJSHULRGDQGWKHQXPEHURI ZRUNLQJGD\VRI&RQWUDFWWLPHUHPDLQLQJ,IWKH&RQWUDFWRUGRHVQRWDJUHHZLWKWKHVWDWHPHQWLW VKDOO ILOH D ZULWWHQ SURWHVW ZLWKLQ GD\V DIWHUUHFHLSW VHWWLQJIRUWKWKHIDFWVRIWKHSURWHVW 2WKHUZLVHWKHVWDWHPHQWZLOOEHGHHPHGWRKDYHEHHQDFFHSWHG &203/(7,21$&&(37$1&($1':$55$17< 6LWH:DON7KURXJK$IWHUWKHVLWHKDVEHHQIXOO\UHVWRUHGWKH,QVSHFWRUZLOOVFKHGXOHDQ LQVSHFWLRQ ZLWKLQ ILYH GD\V RI WKH &RQWUDFWRU¶V UHTXHVW 7KH &RQWUDFWRU DQG ,QVSHFWRU VKDOO DWWHQGWKHLQVSHFWLRQDQGDOORXWVWDQGLQJGHILFLHQFLHVVKDOOEHLGHQWLILHGLQD/LVWRI'HILFLHQFLHV $UHYLHZRIWKHUHGOLQHUHFRUGGUDZLQJVDQGDVVHWVFKHGXOHVKDOODOVREHFRPSOHWHGDWWKH6LWH :DON7KURXJKDQGDOOUHGOLQHGHILFLHQFLHVZLOOEHDGGHGWRWKH/LVWRI'HILFLHQFLHV /LVWRI'HILFLHQFLHV)ROORZLQJWKH6LWH:DON7KURXJKWKH,QVSHFWRUZLOOJHQHUDWHWKH /LVWRI'HILFLHQFLHV DOVRNQRZQDVWKHSXQFKOLVW ZLWKLQILYHZRUNLQJGD\V7KH&RQWUDFWRUVKDOO WKHQKDYHZRUNLQJGD\VWRSHUIRUPFRUUHFWLYHZRUNDQGSURYLGHDZULWWHQUHVSRQVHWRHDFK SXQFKOLVWLWHP 6LWH )ROORZ8S :DON7KURXJK 8SRQ UHFHLSW RI ZULWWHQ UHVSRQVHV WR WKH /LVW RI 'HILFLHQFLHVWKH,QVSHFWRUZLOOFRPSOHWHDIROORZXSLQVSHFWLRQ$Q\RXWVWDQGLQJGHILFLHQFLHVZLOO EHQRWHGDQGUHWXUQHGWRWKH&RQWUDFWRU2XWVWDQGLQJGHILFLHQFLHVZLOOGHOD\IXOOSD\PHQWRIDQ\ UHOHYDQWELGLWHPV 5HTXHVWIRU)LQDO:DON7KURXJK2QFHWKH&RQWUDFWRUDVVHUWVWKH\KDYHVDWLVILHGWKH WHUPVRIWKH&RQWUDFWDQGZLWKWKH,QVSHFWRU¶VSHUPLVVLRQWKH&RQWUDFWRUPD\VXEPLWZULWWHQ DVVHUWLRQ LQ WKH IRUP RI D 5HTXHVW IRU )LQDO :DON7KURXJK FHUWLI\LQJ WKDW DOO GHILFLHQFLHV LGHQWLILHGWKURXJKWKH6LWH:DON7KURXJKSURFHVVKDYHEHHQDGGUHVVHGDQGUHTXHVWD)LQDO ,QVSHFWLRQWRGHPRQVWUDWHSURMHFWFRPSOHWLRQWRWKH$JHQF\7KH&RQWUDFWRUVKDOOSURYLGHDQ DWWDFKPHQWWRWKH5HTXHVWIRU)LQDO,QVSHFWLRQZLWKWKH&RQWUDFWRU¶VZULWWHQUHVSRQVHWRHDFK GHILFLHQF\7KH5HTXHVWIRU)LQDO ,QVSHFWLRQ VKDOO QRW EH FRQVLGHUHG FRPSOHWH ZLWKRXW WKH &RQWUDFWRU¶VZULWWHQUHVSRQVHWRHDFKGHILFLHQF\ )LQDO:DON7KURXJK8SRQUHFHLSWRIWKH5HTXHVWIRU)LQDO:DON7KURXJKWKH,QVSHFWRU VKDOO VFKHGXOH WKH )LQDO ,QVSHFWLRQ 7KH ,QVSHFWRU DQG &RQWUDFWRU VKDOO DWWHQG WKH ILQDO LQVSHFWLRQ5HSUHVHQWDWLYHVIURPRWKHU$JHQF\GHSDUWPHQWVUHVHUYHWKHULJKWWREHSUHVHQWDW WKH)LQDO,QVSHFWLRQ 7KHUHGOLQHUHFRUGGUDZLQJVDQGDVVHWVFKHGXOHVVKDOODOVREHUHYLHZHG ,IDQ\GHILFLHQFLHVDUHQRWVDWLVIDFWRULO\DGGUHVVHGRUDGGLWLRQDOGHILFLHQFLHVDUHLGHQWLILHGWKH &RQWUDFWRUZLOOKDYHZRUNLQJGD\VWRFRPSOHWHWKHFRUUHFWLYHZRUN Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 5HYLVHG&RQWUDFW1R$3DJH RI 5HTXHVWIRU&RPSOHWLRQ7KH(QJLQHHUZLOOQRWDFFHSWWKH:RUNRUDQ\SRUWLRQRIWKH :RUNEHIRUHDOORIWKH:RUNLVFRPSOHWHGDQGDOORXWVWDQGLQJGHILFLHQFLHVDUHFRUUHFWHGE\WKH &RQWUDFWRUDQGWKH(QJLQHHULVVDWLVILHGWKDWDOORIWKH:RUNPHHWVWKHUHTXLUHPHQWVRIWKH &RQWUDFW'RFXPHQWV 2QFHWKH)LQDO:DON7KURXJKKDVEHHQFRPSOHWHGDQGDOORXWVWDQGLQJGHILFLHQFLHVVDWLVIDFWRULO\ FRPSOHWHGWR$JHQF\¶VDSSURYDOWKH&RQWUDFWRUVKDOOVXEPLWDZULWWHQDVVHUWLRQLQWKHIRUPRI 5HTXHVWIRU&RPSOHWLRQOHWWHUFHUWLI\LQJWKDWWKH:RUNKDVEHHQFRPSOHWHG &RPSOHWLRQ8SRQUHFHLSWRIWKH5HTXHVWIRU&RPSOHWLRQOHWWHUWKH$JHQF\VKDOOUHYLHZ WKHZULWWHQDVVHUWLRQZLWKLQZRUNLQJGD\V,ILQWKH(QJLQHHU¶VMXGJPHQWWKH:RUNKDVEHHQ FRPSOHWHGLQDFFRUGDQFHZLWKWKH&RQWUDFW'RFXPHQWVWKH$JHQF\ ZLOO LVVXH D &RPSOHWLRQ /HWWHU 7KHFRPSOHWLRQGDWHZLOOEHWKHGDWHWRZKLFKOLTXLGDWHGGDPDJHVZLOOEHFRPSXWHG 8VH WHPSRUDU\ LQWHULP RU SHUPDQHQW RI DOO RU SRUWLRQV RI WKH :RUN GRHV QRW FRQVWLWXWH FRPSOHWLRQRUDFFHSWDQFHRIWKH:RUN $FFHSWDQFH$FFHSWDQFHZLOORFFXUDIWHUDOOWKHUHTXLUHPHQWVFRQWDLQHGLQWKH&RQWUDFW 'RFXPHQWV KDYH EHHQ IXOILOOHG ,I LQ WKH (QJLQHHU¶V MXGJPHQWWKH &RQWUDFWRU KDV IXOO\ SHUIRUPHGWKH&RQWUDFWWKH(QJLQHHUZLOOVRFHUWLI\WRWKH%RDUG8SRQVXFKFHUWLILFDWLRQE\WKH (QJLQHHU WKH %RDUG PD\ DFFHSW WKH :RUN 8SRQ WKH %RDUG¶V DFFHSWDQFH RI WKH :RUN WKH $JHQF\ZLOOFDXVHD³1RWLFHRI&RPSOHWLRQ´WREHILOHGLQWKHRIILFHRIWKH6DQ'LHJR&RXQW\ 5HFRUGHU7KHGDWHRIUHFRUGDWLRQVKDOOEHWKHGDWHRIDFFHSWDQFHRIWKH:RUN :DUUDQW\$OOZRUNVKDOOEHZDUUDQWHGIRURQH \HDUDIWHUDFFHSWDQFHRIWKH:RUNDQG DQ\IDXOW\ZRUNRUPDWHULDOVGLVFRYHUHGGXULQJWKHZDUUDQW\SHULRGVKDOOEHUHSDLUHGRUUHSODFHG E\WKH&RQWUDFWRUDWLWVH[SHQVH7ZHQW\ILYHSHUFHQWRIWKHIDLWKIXOSHUIRUPDQFHERQGVKDOOEH UHWDLQHGDVDZDUUDQW\ERQGIRUWKHZDUUDQW\SHULRG7KH&RQWUDFWRUVKDOOUHSODFHRUUHSDLUDQ\ VXFKGHIHFWLYHZRUNLQDPDQQHUVDWLVIDFWRU\WRWKH(QJLQHHUDIWHUQRWLFHWRGRVRIURPWKH (QJLQHHU DQG ZLWKLQ WKH WLPH VSHFLILHG LQ WKH QRWLFH ,I WKH &RQWUDFWRU IDLOV WR PDNH VXFK UHSODFHPHQWRUUHSDLUVZLWKLQWKHWLPHVSHFLILHGLQWKHQRWLFHWKH$JHQF\PD\SHUIRUPWKLVZRUN DQGWKH&RQWUDFWRU¶VVXUHWLHVVKDOOEHOLDEOHIRUWKHFRVWWKHUHRI /,48,'$7(''$0$*(6)DLOXUHRIWKH&RQWUDFWRUWRFRPSOHWHWKH:RUNRUDSRUWLRQ WKHUHRIZLWKLQWKHWLPHDOORZHGZLOOUHVXOWLQGDPDJHVEHLQJVXVWDLQHGE\WKH$JHQF\)RUHDFK FRQVHFXWLYHZRUNLQJGD\LQH[FHVVRIWKHWLPHVSHFLILHGIRUFRPSOHWLRQRI:RUNRUDSRUWLRQ WKHUHRIDVDGMXVWHGLQDFFRUGDQFHZLWK6HFWLRQWKH&RQWUDFWRUVKDOOSD\WKH$JHQF\RU KDYH ZLWKKHOG PRQLHV GXH LW WKH VXP RIRQH WKRXVDQG GROODUV 6XFK VXP LV OLTXLGDWHG GDPDJHV DQG VKDOO QRWEH FRQVWUXHG DV D SHQDOW\ DQGPD\ EH GHGXFWHG IURP SD\PHQWVGXHWKH&RQWUDFWRULIVXFKGHOD\RFFXUV ([HFXWLRQRIWKH&RQWUDFWVKDOOFRQVWLWXWHDJUHHPHQWE\WKH$JHQF\DQG&RQWUDFWRUWKDWWKH DPRXQWVSHFLILHGDERYHSHUGD\LVWKHPLQLPXPYDOXHRIFRVWVDQGDFWXDOGDPDJHVFDXVHGE\ WKH&RQWUDFWRUWRFRPSOHWHWKH:RUNZLWKLQWKHDOORWWHGWLPH$Q\SURJUHVVSD\PHQWVPDGHDIWHU WKHVSHFLILHGFRPSOHWLRQGDWHVKDOOQRWFRQVWLWXWHDZDLYHURIWKLVSDUDJUDSKRURIDQ\GDPDJHV 86(2),03529(0(17'85,1*&216758&7,217KH$JHQF\UHVHUYHVWKHULJKWWR WDNHRYHUDQGXWLOL]HDOORUSDUWRIDQ\FRPSOHWHGIDFLOLW\RUDSSXUWHQDQFH7KH&RQWUDFWRUZLOOEH QRWLILHG LQ ZULWLQJ LQ DGYDQFH RI VXFK DFWLRQ 6XFK DFWLRQ E\ WKH $JHQF\ ZLOO UHOLHYH WKH Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 5HYLVHG&RQWUDFW1R$3DJH RI &RQWUDFWRURIUHVSRQVLELOLW\IRULQMXU\RUGDPDJHWRVDLGFRPSOHWHGSRUWLRQVRIWKHLPSURYHPHQW UHVXOWLQJIURPXVHE\SXEOLFWUDIILFRUIURPWKHDFWLRQRIWKHHOHPHQWVRUIURPDQ\RWKHUFDXVH H[FHSW&RQWUDFWRURSHUDWLRQVRUQHJOLJHQFH7KH&RQWUDFWRUZLOOQRWEHUHTXLUHGWRUHFOHDQVXFK SRUWLRQVRIWKHLPSURYHPHQWEHIRUHILHOGDFFHSWDQFHH[FHSWIRUFOHDQXSPDGHQHFHVVDU\E\LWV RSHUDWLRQV 1RWKLQJ LQ WKLV VHFWLRQ VKDOO EH FRQVWUXHG DV UHOLHYLQJ WKH &RQWUDFWRU IURP IXOO UHVSRQVLELOLW\IRUFRUUHFWLQJGHIHFWLYHZRUNRUPDWHULDOV ,QWKHHYHQWWKH$JHQF\H[HUFLVHVLWVULJKWWRSODFHLQWRVHUYLFHDQGXWLOL]HDOORUSDUWRIDQ\ FRPSOHWHGIDFLOLW\RUDSSXUWHQDQFHWKH$JHQF\ZLOODVVXPHWKHUHVSRQVLELOLW\DQGOLDELOLW\IRU LQMXU\ WR SHUVRQV RU SURSHUW\ UHVXOWLQJ IURP WKH XWLOL]DWLRQ RI WKH IDFLOLW\ RU DSSXUWHQDQFH VR SODFHGLQWRVHUYLFHH[FHSWIRUDQ\VXFKLQMXU\WRSHUVRQVRUSURSHUW\FDXVHGE\DQ\ZLOOIXORU QHJOLJHQWDFWRURPLVVLRQE\WKH&RQWUDFWRU6XEFRQWUDFWRUWKHLURIILFHUVHPSOR\HHVRUDJHQWV Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 5HYLVHG&RQWUDFW1R$3DJH RI 6(&7,21±5(63216,%,/,7,(62)7+(&2175$&725 &2175$&725¶6 (48,30(17 $1' )$&,/,7,(6 7KH &RQWUDFWRU VKDOO IXUQLVK DQG PDLQWDLQLQJRRGFRQGLWLRQDOOHTXLSPHQWDQGIDFLOLWLHVDVUHTXLUHGIRUWKHSURSHUH[HFXWLRQDQG LQVSHFWLRQRIWKH:RUN6XFKHTXLSPHQWDQGIDFLOLWLHVVKDOOPHHWDOOUHTXLUHPHQWVRIDSSOLFDEOH RUGLQDQFHVDQGODZV /$%25 *HQHUDO 2QO\ FRPSHWHQW ZRUNHUV VKDOO EH HPSOR\HG RQ WKH :RUN $Q\ SHUVRQ HPSOR\HGZKRLVIRXQGWREHLQFRPSHWHQWLQWHPSHUDWHWURXEOHVRPHGLVRUGHUO\RURWKHUZLVH REMHFWLRQDEOH RU ZKR IDLOV RU UHIXVHV WR SHUIRUP ZRUN SURSHUO\ DQG DFFHSWDEO\ VKDOO EH LPPHGLDWHO\UHPRYHGIURPWKH:RUNE\WKH&RQWUDFWRUDQGQRWEHUHHPSOR\HGRQWKH:RUN /DZV7KH&RQWUDFWRULWVDJHQWVDQGHPSOR\HHVVKDOOEHERXQGE\DQGFRPSO\ZLWK DSSOLFDEOHSURYLVLRQVRIWKH/DERU&RGHDQG)HGHUDO6WDWHDQGORFDOODZVUHODWHGWRODERU 7KH&RQWUDFWRUVKDOOVWULFWO\DGKHUHWRWKHSURYLVLRQVRIWKH/DERU&RGHUHJDUGLQJPLQLPXP ZDJHV WKHKRXUGD\DQGKRXUZHHN RYHUWLPH 6DWXUGD\6XQGD\DQGKROLGD\ZRUN DQG QRQGLVFULPLQDWLRQEHFDXVHRIUDFHFRORUQDWLRQDORULJLQVH[RUUHOLJLRQ7KH&RQWUDFWRUVKDOO IRUIHLWWRWKH$JHQF\WKHSHQDOWLHVSUHVFULEHGLQWKH/DERU&RGHIRUYLRODWLRQV ,Q DFFRUGDQFH ZLWK WKH /DERU &RGH WKH %RDUG KDV RQ ILOH DQG ZLOO SXEOLVK D VFKHGXOH RI SUHYDLOLQJZDJHUDWHVIRUWKHW\SHVRIZRUNWREHGRQHXQGHUWKH&RQWUDFW7KH&RQWUDFWRUVKDOO QRWSD\OHVVWKDQWKHVHUDWHV (DFK ZRUNHU VKDOO EH SDLG VXEVLVWHQFH DQG WUDYHO DV UHTXLUHG E\ WKH FROOHFWLYH EDUJDLQLQJ DJUHHPHQWRQILOHZLWKWKH6WDWHRI&DOLIRUQLD'HSDUWPHQWRI,QGXVWULDO5HODWLRQV 7KH &RQWUDFWRU¶V DWWHQWLRQ LV GLUHFWHG WR 6HFWLRQ RI WKH /DERU &RGH ZKLFK LPSRVHV UHVSRQVLELOLW\ XSRQ WKH &RQWUDFWRU IRU WKH PDLQWHQDQFH FHUWLILFDWLRQ DQG DYDLODELOLW\ IRU LQVSHFWLRQ RI VXFK UHFRUGV IRU DOO SHUVRQV HPSOR\HG E\ WKH &RQWUDFWRU RU 6XEFRQWUDFWRU LQ FRQQHFWLRQZLWKWKHSURMHFW7KH&RQWUDFWRUVKDOODJUHHWKURXJKWKH&RQWUDFWWRFRPSO\ZLWKWKLV 6HFWLRQDQGWKHUHPDLQLQJSURYLVLRQVRIWKH/DERU&RGH /,$%,/,7<,1685$1&(,QVXUDQFHVKDOOEHUHTXLUHGDVVSHFLILHGLQVHFWLRQRIWKH 3XEOLF:RUNV&RQWUDFW 7KHFRVWRIWKLVLQVXUDQFHVKDOOEHLQFOXGHGLQWKH&RQWUDFWRU¶V%LG :25.(56¶&203(16$7,21,1685$1&(%HIRUHH[HFXWLRQRIWKH&RQWUDFWE\WKH %RDUGWKH&RQWUDFWRUVKDOOILOHZLWKWKH(QJLQHHUWKHIROORZLQJVLJQHGFHUWLILFDWLRQ ³,DPDZDUHRIWKHSURYLVLRQVRI6HFWLRQRIWKH/DERU&RGHZKLFKUHTXLUH HYHU\HPSOR\HUWREHLQVXUHGDJDLQVWOLDELOLW\IRUZRUNHUV¶FRPSHQVDWLRQRUWR XQGHUWDNHVHOILQVXUDQFHLQDFFRUGDQFHZLWKWKHSURYLVLRQVRIWKDWFRGHDQG,ZLOO FRPSO\ZLWKVXFKSURYLVLRQVEHIRUHFRPPHQFLQJWKHSHUIRUPDQFHRIWKHZRUNRI WKLVFRQWUDFW´ Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 5HYLVHG&RQWUDFW1R$3DJH RI 7KH&RQWUDFWRUVKDOODOVRFRPSO\ZLWK6HFWLRQRIWKH/DERU&RGHE\VHFXULQJSD\LQJIRU DQG PDLQWDLQLQJ LQ IXOO IRUFH DQG HIIHFW IRU WKH GXUDWLRQ RI WKH FRQWUDFW FRPSOHWH :RUNHUV¶ &RPSHQVDWLRQ,QVXUDQFHDQGVKDOOIXUQLVKD&HUWLILFDWHRI,QVXUDQFHWRWKH(QJLQHHUEHIRUH H[HFXWLRQRIWKH&RQWUDFW7KH$JHQF\LWVRIILFHUVRUHPSOR\HHVZLOOQRWEHUHVSRQVLEOHIRUDQ\ FODLPVLQODZRUHTXLW\RFFDVLRQHGE\IDLOXUHRIWKH&RQWUDFWRUWRFRPSO\ZLWKWKLVSDUDJUDSK $OOFRPSHQVDWLRQLQVXUDQFHSROLFLHVVKDOOEHDUDQHQGRUVHPHQWRUVKDOOKDYHDWWDFKHGDULGHU ZKHUHE\LWLVSURYLGHGWKDWLQWKHHYHQWRIH[SLUDWLRQRUSURSRVHGFDQFHOODWLRQRIVXFKSROLFLHV IRUDQ\UHDVRQZKDWVRHYHUWKH$JHQF\VKDOOEHQRWLILHGE\UHJLVWHUHGPDLOQRWOHVVWKDQGD\V EHIRUHH[SLUDWLRQRUFDQFHOODWLRQLVHIIHFWLYH $OOLQVXUDQFHLVWREHSODFHGZLWKLQVXUHUVWKDWDUHDGPLWWHGDQGDXWKRUL]HGWRFRQGXFWEXVLQHVV LQWKHVWDWHRI&DOLIRUQLDDQGDUHOLVWHGLQWKHRIILFLDOSXEOLFDWLRQRIWKH'HSDUWPHQWRI,QVXUDQFH RI WKH 6WDWH RI &DOLIRUQLD 3ROLFLHV LVVXHG E\ WKH 6WDWH &RPSHQVDWLRQ)XQGPHHWWKH UHTXLUHPHQWIRUZRUNHUV FRPSHQVDWLRQLQVXUDQFH 3(50,76 ([FHSW DV VSHFLILHG KHUHLQ WKH &RQWUDFWRU ZLOO REWDLQ DOO &LW\ RI &DUOVEDG HQFURDFKPHQWULJKWRIZD\JUDGLQJDQGEXLOGLQJSHUPLWVQHFHVVDU\WRSHUIRUPZRUNIRUWKLV FRQWUDFWRQ$JHQF\SURSHUW\VWUHHWVRURWKHUULJKWVRIZD\&RQWUDFWRUVKDOOQRWEHJLQZRUNXQWLO DOO SHUPLWV LQFLGHQWDO WR WKH ZRUN DUH REWDLQHG 7KH &RQWUDFWRU VKDOO REWDLQ DQG SD\ IRU DOO SHUPLWVIRUWKHGLVSRVDORIDOOPDWHULDOVUHPRYHGIURPWKHSURMHFW7KHFRVWRIVDLGSHUPLW V VKDOOEHLQFOXGHGLQWKHSULFHELGIRUWKHDSSURSULDWHELGLWHPDQGQRDGGLWLRQDOFRPSHQVDWLRQ ZLOOEHDOORZHGWKHUHIRU7KH&RQWUDFWRUVKDOOREWDLQDQGSD\IRUDOOFRVWVLQFXUUHGIRUSHUPLWV QHFHVVLWDWHGE\LWVRSHUDWLRQVVXFKDVEXWQRWOLPLWHGWRWKRVHSHUPLWVUHTXLUHGIRUQLJKWZRUN RYHUVL]HORDGEODVWLQJDQGGHPROLWLRQ 7KH&RQWUDFWRUVKDOOSD\DOOEXVLQHVVWD[HVRUOLFHQVHIHHVWKDWDUHUHTXLUHGIRUWKH:RUN $LU3ROOXWLRQ&RQWURO3HUPLWV7KHXVHRIPDWHULDOVRUDFWLYLWLHVWKDWFDQJHQHUDWHDLU HPLVVLRQV DUH UHJXODWHG E\ WKH &DOLIRUQLD $LU 5HVRXUFH %RDUG &$5% DQGWKH6DQ'LHJR &RXQW\$LU3ROOXWLRQ&RQWURO'LVWULFW 6'$3&' DQGHLWKHUUHTXLUHSHUPLWVRUDUHVXEMHFWWRVWDWH RUORFDODLUUHJXODWLRQVZKLFKHVWDEOLVKOLPLWDWLRQVRQHTXLSPHQWRUSURGXFWXVHRU92&FRQWHQW DQGUHTXLUHPHQWVIRUUHFRUGNHHSLQJDQGUHSRUWLQJ7KHVHPDWHULDOVDQGDFWLYLWLHVLQFOXGHEXW DUHQRWOLPLWHGWRWKHIROORZLQJ x $EUDVLYHEODVWLQJ x $GKHVLYHV x $VEHVWRVDEDWHPHQWUHPRYDORUGLVUXSWLRQ x &RDWLQJRUSDLQWLQJ x &RQFUHWHFXULQJFRPSRXQGV x 'HPROLWLRQRIEXLOGLQJVHTXLSPHQWRUVWUXFWXUHV x )LEHUJODVVSRO\HVWHUUHVLQOD\XSRUPDFKLQLQJ x 2SHUDWLRQ RI QRQURDG GLHVHO HQJLQHV JUHDWHU WKDQ KS LQFOXGLQJ JHQHUDWRUV FRPSUHVVRUVSXPSVK\GUREODVWHUVHWF x 2SHUDWLRQRIRIIURDGGLHVHOHQJLQHVJUHDWHUWKDQKS LQFOXGLQJIRUNOLIWVFRQVWUXFWLRQ HTXLSPHQWORDGKDQGOHUVHWF x6ROYHQWV x :HOGLQJ Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 5HYLVHG&RQWUDFW1R$3DJH RI 2SHUDWRUVRISRUWDEOHHQJLQHVDQGRWKHUW\SHVRIHTXLSPHQWFDQUHJLVWHUWKHLUXQLWVXQGHUWKH &$5%6WDWHZLGH3RUWDEOH(TXLSPHQW5HJLVWUDWLRQ3URJUDP 3(53 LQRUGHUWRRSHUDWHWKHLU HTXLSPHQWWKURXJKRXW&DOLIRUQLD+RZHYHUWKHXVHRISRUWDEOHHTXLSPHQW HJE\SDVVSXPSV WRSHUIRUPWKHIXQFWLRQRISHUPLWWHGVWDWLRQDU\HTXLSPHQWLVVXEMHFWWR6'$3&'UHJXODWLRQLQ DGGLWLRQWR&$5%UHTXLUHPHQWV 'LHVHOHQJLQH GULYHQ JHQHUDWRUV RU HTXLSPHQW VKDOO KDYH D YDOLG SHUPLW RU UHJLVWUDWLRQ LQ DFFRUGDQFHZLWKWKH&DOLIRUQLD$LU5HVRXUFHV%RDUGDQGRUWKH6DQ'LHJR&RXQW\$LU3ROOXWLRQ &RQWURO'LVWULFWUHJXODWLRQVSULRUWRPRELOL]DWLRQWRWKHVLWH7KH&RQWUDFWRUVKDOOVXEPLWDFRS\RI WKHSHUPLWRUUHJLVWUDWLRQGRFXPHQWVIRUDOOHTXLSPHQWVXEMHFWWR VWDWH RU ORFDO DLU SROOXWLRQ FRQWUROUHJXODWLRQVDQGPDLQWDLQWKHSHUPLWRUUHJLVWUDWLRQGRFXPHQWVLQYDOLGVWDQGLQJGXULQJ WKHSHUIRUPDQFHRIWKH:RUN 3URGXFWVVXFKDVSDLQWVDGKHVLYHVUHVLQVVROYHQWVDQGRWKHUSURGXFWVVKDOOFRPSO\ZLWKWKH 9RODWLOH2UJDQLF&RPSRXQG 92& FRQWHQWOLPLWVHVWDEOLVKHGE\&$5%DQGRUWKH6'$3&' 7KH&RQWUDFWRUVKDOOEHUHVSRQVLEOHIRUGHWHUPLQLQJWKDWVXFKSURGXFWVFDQEHXVHGOHJDOO\LQ WKHSHUIRUPDQFHRIWKH:RUN7KH&RQWUDFWRUVKDOOPDLQWDLQDQG VXEPLWUHFRUGVWRWKH&LW\ (QJLQHHU RQ WKH TXDQWLWLHV RI SDLQWVRUVROYHQWVXVHGDVPD\EH UHTXLUHG E\ DSSOLFDEOH UHJXODWLRQV 3ULRUWRVWDUWLQJDQ\DFWLYLW\WKDWLVUHTXLUHGWRKDYHDQDLUSROOXWLRQFRQWUROSHUPLWRUUHJLVWUDWLRQ WKH&RQWUDFWRUVKDOOYHULI\WKHDSSOLFDELOLW\RIWKHODWHVWDLUSROOXWLRQFRQWUROUHJXODWLRQVSHUWDLQLQJ WRWKHSURSRVHGPDWHULDOVHTXLSPHQWDQGRSHUDWLRQVDQGREWDLQDQGFRPSO\ZLWKDSSOLFDEOH UHTXLUHPHQWV x 5XOH±([HPSWLRQVIURP5XOH3HUPLW5HTXLUHPHQWV 5XOH±5HJLVWUDWLRQRI6SHFLILHG(TXLSPHQW x 5XOH±3RUWDEOH(TXLSPHQW5HJLVWUDWLRQ x 5XOH±1XLVDQFH x 5XOH±$UFKLWHFWXUDO&RDWLQJV x 5XOH±6WRUDJHRI0DWHULDOV&RQWDLQLQJ9RODWLOH2UJDQLF&RPSRXQGV x 5XOH±$EUDVLYH%ODVWLQJ 6DQ'LHJR$LU3ROOXWLRQ&RQWURO'LVWULFW KWWSV ZZZVGDSFGRUJFRQWHQWVGDSFGSHUPLWVKWPO &DOLIRUQLD$LU5HVRXUFH%RDUG KWWSV ZZDUEFDJRYRXUZRUNSURJUDPVSRUWDEOHHTXLSPHQWUHJLVWUDWLRQSURJUDPSHUSDERXW 7+(&2175$&725¶65(35(6(17$7,9(%HIRUHVWDUWLQJZRUNWKH&RQWUDFWRUVKDOO GHVLJQDWH LQ ZULWLQJ D UHSUHVHQWDWLYH ZKR VKDOO KDYH FRPSOHWH DXWKRULW\ WR DFW IRU LW $Q DOWHUQDWLYHUHSUHVHQWDWLYHPD\EHGHVLJQDWHGDVZHOO7KHUHSUHVHQWDWLYHRUDOWHUQDWHVKDOOEH SUHVHQWDWWKH:RUNVLWHZKHQHYHUZRUNLVLQSURJUHVVRUZKHQHYHUDFWLRQVRIWKHHOHPHQWV QHFHVVLWDWHLWVSUHVHQFHWRWDNHPHDVXUHVQHFHVVDU\WRSURWHFWWKH:RUNSHUVRQVRUSURSHUW\ $Q\ RUGHU RU FRPPXQLFDWLRQ JLYHQ WR WKLV UHSUHVHQWDWLYH VKDOO EH GHHPHG GHOLYHUHG WR WKH &RQWUDFWRU$MRLQWYHQWXUHVKDOOGHVLJQDWHRQO\RQHUHSUHVHQWDWLYHDQGDOWHUQDWH,QWKHDEVHQFH RIWKH&RQWUDFWRURULWVUHSUHVHQWDWLYHLQVWUXFWLRQVRUGLUHFWLRQVPD\EHJLYHQE\WKH(QJLQHHUWR WKHVXSHULQWHQGHQWRUSHUVRQLQFKDUJHRIWKHVSHFLILFZRUNWRZKLFKWKHRUGHUDSSOLHV6XFK RUGHUVKDOOEHFRPSOLHGZLWKSURPSWO\DQGUHIHUUHGWRWKH&RQWUDFWRURULWVUHSUHVHQWDWLYH Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 5HYLVHG&RQWUDFW1R$3DJH RI ,QRUGHUWRFRPPXQLFDWHZLWKWKH$JHQF\WKH&RQWUDFWRU¶VUHSUHVHQWDWLYHVXSHULQWHQGHQWRU SHUVRQLQFKDUJHRIVSHFLILFZRUNVKDOOEHDEOHWRVSHDNUHDGDQGZULWHWKH(QJOLVKODQJXDJH 7KHTXDOLILFDWLRQVIRUWKH&RQWUDFWRU¶V5HSUHVHQWDWLYHVKDOOLQFOXGHDWDPLQLPXP $WOHDVWILYH\HDUVRIH[SHULHQFHLQDVXSHULQWHQGHQWFDSDFLW\IRUSURMHFWVWKDWDUHVLPLODU LQVFRSHDQGFRVWWRWKHSURMHFWVLGHQWLILHGLQWKH&RQWUDFWRU¶V6WDWHPHQWRI7HFKQLFDO $ELOLW\ DQG ([SHULHQFH VXEPLWWHG ZLWK WKH ELG DQG VXFFHVVIXO FRPSOHWLRQ RI DW OHDVW WKUHH SURMHFWV LQYROYLQJ FRDWLQJ VWHHO ZDWHU WDQNV ZLWK FRQWUDFWYDOXHVRIDWOHDVW $PLQLPXPRIRQHSURMHFWVKDOOGLVSOD\H[SHULHQFHZLWKOHDGEDVHGSDLQW DEDWHPHQW 7KH &RQWUDFWRU VKDOO EH UHVSRQVLEOH IRU VXEPLWWLQJ YHULILDEOH H[SHULHQFH UHFRUGV &RPSOHWLRQRI26+$KRXUFRQVWUXFWLRQWUDLQLQJFRXUVH6XEPLWFHUWLILFDWLRQDVSURRI ,QWKHHYHQWWKDWWKH&RQWUDFWRUSURSRVHVWRFKDQJHWKH&RQWUDFWRU V5HSUHVHQWDWLYHSULRUWR 3URMHFWFRPSOHWLRQWKH&RQWUDFWRUVKDOOQRWLI\WKH$JHQF\DQGVXEPLWWKHTXDOLILFDWLRQVRIWKH SURSRVHG&RQWUDFWRU V5HSUHVHQWDWLYHIRUWKH(QJLQHHU VUHYLHZDWOHDVWWZRZHHNVSULRUWRWKH SURSRVHGFKDQJH7KHTXDOLILFDWLRQVVKDOOGHPRQVWUDWHWKDWWKHPLQLPXPUHTXLUHPHQWVRIWKH SRVLWLRQ DV GHVFULEHG KHUHLQ DUH VDWLVILHG 7KH (QJLQHHU ZLOO UHYLHZ WKH TXDOLILFDWLRQV RI SURSRVHG&RQWUDFWRU V5HSUHVHQWDWLYHZLWKLQZRUNLQJGD\VRIUHFHLSW 1RFKDQJHLQ&RQWUDFWRU V5HSUHVHQWDWLYHZLOOEHDOORZHGZLWKRXWWKH$JHQF\ VDSSURYDO,QWKH HYHQWRIDFKDQJHLQ&RQWUDFWRU V5HSUHVHQWDWLYHZLWKRXWSULRUDSSURYDO$JHQF\UHVHUYHVWKH ULJKWWRVXVSHQGZRUNDWWKH&RQWUDFWRU VFRVWXQWLODTXDOLILHG&RQWUDFWRU V5HSUHVHQWDWLYHLV DSSURYHGIRUWKH3URMHFW &223(5$7,21$1'&2//$7(5$/:25.7KH&RQWUDFWRUVKDOOEHUHVSRQVLEOHIRU DVFHUWDLQLQJWKHQDWXUHDQGH[WHQWRIDQ\VLPXOWDQHRXVFROODWHUDODQGHVVHQWLDOZRUNE\RWKHUV 7KH$JHQF\LWVZRUNHUVDQGFRQWUDFWRUVDQGRWKHUVVKDOOKDYHWKHULJKWWRRSHUDWHZLWKLQRU DGMDFHQWWRWKH:RUNVLWHGXULQJWKHSHUIRUPDQFHRIVXFKZRUN 7KH$JHQF\WKH&RQWUDFWRUDQGHDFKRIVXFKZRUNHUVFRQWUDFWRUVDQGRWKHUVVKDOOFRRUGLQDWH WKHLURSHUDWLRQVDQGFRRSHUDWHWRPLQLPL]HLQWHUIHUHQFH 7KH&RQWUDFWRUVKDOOLQFOXGHLQLWV%LGDOOFRVWVLQYROYHGDVDUHVXOWRIFRRUGLQDWLQJLWVZRUNZLWK RWKHUV WKH &RQWUDFWRU ZLOO QRW EH HQWLWOHG WR DGGLWLRQDO FRPSHQVDWLRQ IURP WKH $JHQF\ IRU GDPDJHVUHVXOWLQJIURPVXFKVLPXOWDQHRXVFROODWHUDODQGHVVHQWLDOZRUN,IQHFHVVDU\WRDYRLG RUPLQLPL]HVXFKGDPDJHRUGHOD\WKH&RQWUDFWRUVKDOOUHGHSOR\LWVZRUNIRUFHWRRWKHUSDUWVRI WKH:RUN 6KRXOG WKH &RQWUDFWRU EH GHOD\HG E\ WKH $JHQF\ DQG VXFK GHOD\FRXOG QRW KDYH EHHQ UHDVRQDEO\IRUHVHHQRUSUHYHQWHGE\WKH&RQWUDFWRUWKH(QJLQHHUZLOOGHWHUPLQHWKHH[WHQWRI WKHGHOD\WKHHIIHFWRQWKHSURMHFWDQGDQ\H[WHQVLRQRIWLPH &RRUGLQDWLRQ7KH&RQWUDFWRUVKDOOFRRUGLQDWHDQGFRRSHUDWHZLWKDOOXWLOLW\FRPSDQLHV GXULQJ WKH PDUNRXW DQG ORFDWLQJRIWKHLUOLQHVRUGXULQJWKHLU UHORFDWLRQ RU FRQVWUXFWLRQ LI QHFHVVDU\7KH&RQWUDFWRUPD\EHJUDQWHGDWLPHH[WHQVLRQLILQWKHRSLQLRQRIWKH(QJLQHHUD GHOD\ LV FDXVHG E\ WKH XWLOLW\ FRPSDQ\ 1R DGGLWLRQDO FRPSHQVDWLRQ ZLOO EH PDGH WR WKH &RQWUDFWRUIRUDQ\VXFKGHOD\ Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 5HYLVHG&RQWUDFW1R$3DJH RI 6LWH$FFHVV7KHSURMHFWVLWHVDUHORFDWHGZLWKLQDVHFXUHG&0:'SURSHUW\$WWKHVWDUW RISURMHFWWKH&RQWUDFWRUVKDOOSURYLGHDQGµGDLV\FKDLQ¶WKHLURZQORFNRQWKHORFNFKDLQDQG UHPRYHXSRQGHPRELOL]LQJIURPWKHVLWH 352-(&76,7(0$,17(1$1&( &OHDQXS DQG 'XVW &RQWURO 7KURXJKRXW DOO SKDVHV RI FRQVWUXFWLRQ LQFOXGLQJ VXVSHQVLRQRIZRUNDQGXQWLOWKHILQDODFFHSWDQFHWKH&RQWUDFWRUVKDOONHHSWKHVLWHFOHDQDQG IUHH IURP UXEELVK DQG GHEULV 7KH &RQWUDFWRU VKDOO DOVR DEDWH GXVW QXLVDQFH E\ FOHDQLQJ VZHHSLQJDQGVSULQNOLQJZLWKZDWHURURWKHUPHDQVDVQHFHVVDU\7KHXVHRIZDWHUUHVXOWLQJLQ PXGRQSXEOLFVWUHHWVZLOOQRWEHSHUPLWWHGDVDVXEVWLWXWHIRUVZHHSLQJRURWKHUPHWKRGV :KHQUHTXLUHGE\WKH3ODQVRU6SHFLILFDWLRQVWKH&RQWUDFWRUVKDOOIXUQLVKDQGRSHUDWHDVHOI ORDGLQJPRWRUVZHHSHUZLWKVSUD\QR]]OHVDWOHDVWRQFHHDFKZRUNLQJGD\IRUWKHSXUSRVHRI NHHSLQJ SDYHG DUHDV DFFHSWDEO\ FOHDQ ZKHUHYHU FRQVWUXFWLRQ LQFOXGLQJ UHVWRUDWLRQ LV LQFRPSOHWH 0DWHULDOV DQG HTXLSPHQW VKDOO EH UHPRYHG IURP WKH VLWH DV VRRQDV WKH\ DUH QR ORQJHU QHFHVVDU\%HIRUHWKHILQDOLQVSHFWLRQWKHVLWHVKDOOEHFOHDUHGRIHTXLSPHQWXQXVHGPDWHULDOV DQGUXEELVKVRDVWRSUHVHQWDVDWLVIDFWRU\FOHDQDQGQHDWDSSHDUDQFH$OOFOHDQXSFRVWVVKDOO EHLQFOXGHGLQWKH&RQWUDFWRU¶V%LG &DUHVKDOOEHWDNHQWRSUHYHQWVSLOODJHRQKDXOURXWHV$Q\VXFKVSLOODJHVKDOOEHUHPRYHG LPPHGLDWHO\DQGWKHDUHDFOHDQHG ([FHVVH[FDYDWLRQPDWHULDOIURPFDWFKEDVLQVRUVLPLODUVWUXFWXUHVVKDOOEHUHPRYHGIURPWKH VLWH LPPHGLDWHO\ 6XIILFLHQW PDWHULDO PD\ UHPDLQ IRU XVH DV EDFNILOO LI SHUPLWWHG E\ WKH 6SHFLILFDWLRQV)RUPVDQGIRUPOXPEHUVKDOOEHUHPRYHGIURPWKHVLWHDVVRRQDVSUDFWLFDEOH DIWHUVWULSSLQJ )DLOXUHRIWKH&RQWUDFWRUWRFRPSO\ZLWKWKH(QJLQHHU¶VFOHDQXSRUGHUVPD\UHVXOWLQDQRUGHUWR VXVSHQGZRUNXQWLOWKHFRQGLWLRQLVFRUUHFWHG1RDGGLWLRQDOFRPSHQVDWLRQZLOOEHDOORZHGDVD UHVXOWRIVXFKVXVSHQVLRQ &OHDQXS DQG GXVW FRQWURO UHTXLUHG KHUHLQ VKDOO DOVR EH H[HFXWHG RQ ZHHNHQGV DQG RWKHU QRQZRUNLQJ GD\V ZKHQ QHHGHG WR SUHVHUYH WKH KHDOWK VDIHW\ RU ZHOIDUH RIWKH SXEOLF7KH &RQWUDFWRU VKDOO FRQGXFW HIIHFWLYH FOHDQXS DQG GXVW FRQWURO WKURXJKRXW WKH GXUDWLRQ RI WKH &RQWUDFW7KH(QJLQHHUPD\UHTXLUHLQFUHDVHGOHYHOVRIFOHDQXSDQGGXVWFRQWUROWKDWLQKLVKHU VROHGLVFUHWLRQDUHQHFHVVDU\WRSUHVHUYHWKHKHDOWKVDIHW\DQGZHOIDUHRIWKHSXEOLF&OHDQXS DQGGXVWFRQWUROVKDOOEHFRQVLGHUHGLQFLGHQWDOWRWKHLWHPVRIZRUNWKDWWKH\DUHDVVRFLDWHGZLWK DQGQRDGGLWLRQDOSD\PHQWZLOOEHPDGHWKHUHIRUH $LU3ROOXWLRQ&RQWURO7KH&RQWUDFWRUVKDOOQRWGLVFKDUJHVPRNHGXVWRUDQ\RWKHUDLU FRQWDPLQDQWVLQWRWKHDWPRVSKHUHLQVXFKTXDQWLW\DVZLOOYLRODWHWKHUHJXODWLRQVRIDQ\OHJDOO\ FRQVWLWXWHGDXWKRULW\ 9HUPLQ&RQWURO$WWKHWLPHRIDFFHSWDQFHVWUXFWXUHVHQWLUHO\FRQVWUXFWHGXQGHUWKH &RQWUDFWVKDOOEHIUHHRIURGHQWVLQVHFWVYHUPLQDQGSHVWV1HFHVVDU\H[WHUPLQDWLRQZRUN VKDOOEHDUUDQJHGDQGSDLGIRUE\WKH&RQWUDFWRUDVSDUWRIWKH:RUNZLWKLQWKH&RQWUDFWWLPH DQG VKDOO EH SHUIRUPHG E\ D OLFHQVHG H[WHUPLQDWRU LQ DFFRUGDQFH ZLWK UHTXLUHPHQWV RI Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 5HYLVHG&RQWUDFW1R$3DJH RI JRYHUQLQJ DXWKRULWLHV 7KH &RQWUDFWRU VKDOO EH OLDEOH IRU LQMXU\WRSHUVRQVRUSURSHUW\DQG UHVSRQVLEOHIRUWKHHOLPLQDWLRQRIRIIHQVLYHRGRUVUHVXOWLQJIURPH[WHUPLQDWLRQRSHUDWLRQV 6DQLWDWLRQ7KH&RQWUDFWRUVKDOOSURYLGHDQGPDLQWDLQHQFORVHGWRLOHWVIRUWKHXVHRI HPSOR\HHVHQJDJHGLQWKH:RUN7KHVHDFFRPPRGDWLRQVVKDOOEHPDLQWDLQHGLQDQHDWDQG VDQLWDU\FRQGLWLRQ7KH\VKDOODOVRFRPSO\ZLWKDOODSSOLFDEOHODZVRUGLQDQFHVDQGUHJXODWLRQV SHUWDLQLQJWRSXEOLFKHDOWKDQGVDQLWDWLRQRIGZHOOLQJVDQGFDPSV :DVWHZDWHU VKDOO QRW EH LQWHUUXSWHG 6KRXOG WKH &RQWUDFWRU GLVUXSW H[LVWLQJ VHZHU IDFLOLWLHV VHZDJH VKDOO EH FRQYH\HG LQ FORVHG FRQGXLWV DQG GLVSRVHG RI LQD VDQLWDU\ VHZHU V\VWHP 6HZDJHVKDOOQRWEHSHUPLWWHGWRIORZLQWUHQFKHVRUEHFRYHUHGE\EDFNILOO 7HPSRUDU\/LJKW3RZHUDQG:DWHU7KH&RQWUDFWRUVKDOOIXUQLVKLQVWDOOPDLQWDLQ DQGUHPRYHDOOWHPSRUDU\OLJKWSRZHUDQGZDWHUDWLWVRZQH[SHQVH7KHVHLQFOXGHSLSLQJ ZLULQJODPSVDQGRWKHUHTXLSPHQWQHFHVVDU\IRUWKH:RUN7KH&RQWUDFWRUVKDOOQRWGUDZZDWHU IURPDQ\ILUHK\GUDQW H[FHSWWRH[WLQJXLVKDILUH ZLWKRXWREWDLQLQJSHUPLVVLRQIURPWKHZDWHU DJHQF\ FRQFHUQHG 7KH &RQWUDFWRU VKDOO REWDLQ D FRQVWUXFWLRQPHWHUIRU ZDWHU XVHGIRU WKH FRQVWUXFWLRQSODQWHVWDEOLVKPHQWPDLQWHQDQFHFOHDQXSWHVWLQJDQGDOORWKHUZRUNUHTXLULQJ ZDWHUUHODWHGWRWKLVFRQWUDFW7KH&RQWUDFWRUVKDOOFRQWDFWWKHDSSURSULDWHZDWHUDJHQF\IRU UHTXLUHPHQWV7KH&RQWUDFWRUVKDOOSD\DOOFRVWVRIWHPSRUDU\OLJKWSRZHUDQGZDWHULQFOXGLQJ KRRNXSVHUYLFHPHWHUDQGDQ\DQGDOORWKHUFKDUJHVGHSRVLWVDQGRUIHHVWKHUHIRU6DLGFRVWV VKDOO EH FRQVLGHUHG LQFLGHQWDO WR WKH LWHPV RI ZRUN WKDW WKH\ DUH DVVRFLDWHG ZLWK DQG QR DGGLWLRQDOSD\PHQWZLOOEHPDGHWKHUHIRU :DWHU3ROOXWLRQ&RQWURO7KH&RQWUDFWRUVKDOOH[HUFLVHHYHU\UHDVRQDEOHSUHFDXWLRQWR SURWHFWFKDQQHOVVWRUPGUDLQVDQGERGLHVRIZDWHUIURPSROOXWLRQ,WVKDOOFRQGXFWDQGVFKHGXOH RSHUDWLRQVVRDVWRPLQLPL]HRUDYRLGPXGG\LQJDQGVLOWLQJRIVDLGFKDQQHOVGUDLQVDQGZDWHUV :DWHUSROOXWLRQFRQWUROZRUNVKDOOFRQVLVWRIFRQVWUXFWLQJWKRVHIDFLOLWLHVZKLFKPD\EHUHTXLUHG WRSURYLGHSUHYHQWLRQFRQWURODQGDEDWHPHQWRIZDWHUSROOXWLRQ 7KH&RQWUDFWRUVKDOOFRPSO\ZLWKWKH&DOLIRUQLD6WDWH:DWHU5HVRXUFHV&RQWURO%RDUG 6:5&% 2UGHU 1XPEHU 5 1DWLRQDO 3ROOXWDQW 'LVFKDUJH (OLPLQDWLRQ 6\VWHP 13'(6 3HUPLWDQG:DVWH'LVFKDUJH5HTXLUHPHQWVIRU'LVFKDUJHVIURPWKH0XQLFLSDO6HSDUDWH6WRUP 6HZHU 6\VWHPV 06V 'UDLQLQJ WKH :DWHUVKHGV ZLWKLQ WKH 6DQ 'LHJR 5HJLRQ DQG DPHQGPHQWVWKHUHWRDQGZLWKDOOUHTXLUHPHQWVRIWKH6WRUP:DWHU3ROOXWLRQ3UHYHQWLRQ3ODQIRU WKLVSURMHFWLQDFFRUGDQFHZLWKWKHVHUHJXODWLRQV 7KH&RQWUDFWRUVKDOOEHUHVSRQVLEOHIRUWKHSUHSDUDWLRQDQGLPSOHPHQWDWLRQRIWKH6WRUP:DWHU 3ROOXWLRQ3UHYHQWLRQ3ODQ 6:333 IRUHDFKVLWHORFDWLRQ7HPSODWHVDUHDYDLODEOHDWWKH&LW\¶V ZHEVLWHDQGIROORZLQJ/LQN (QJLQHHULQJ$SSOLFDWLRQV )RUPV_&DUOVEDG&$ FDUOVEDGFDJRY 6:333VDUHWREHGHVLJQHGLQDFFRUGDQFHZLWKWKH&LW\RI&DUOVEDG(QJLQHHULQJ6WDQGDUGV 9ROXPHSWPPP ManualDQGDUHVXEMHFWWRDSSURYDOE\WKH&LW\ 'HZDWHULQJ 'HZDWHULQJ VKDOO EH SHUIRUPHG E\ WKH &RQWUDFWRU ZKHQ VSHFLILFDOO\ UHTXLUHGE\WKH3ODQVRU6SHFLILFDWLRQVRUVSHFLILHGLQWKHELGVFKHGXOHDQGDVQHFHVVDU\IRU FRQVWUXFWLRQRIWKH:RUN'HZDWHULQJVKDOOEHSHUIRUPHGLQFRQIRUPDQFHZLWKDOO DSSOLFDEOH ORFDOVWDWHDQG)HGHUDOODZVDQGSHUPLWVLVVXHGE\MXULVGLFWLRQDOUHJXODWRU\DJHQFLHV Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 5HYLVHG&RQWUDFW1R$3DJH RI 3HUPLWVQHFHVVDU\IRUWKHGLVFKDUJHRIJURXQGZDWHUWRODQGRUWKHVDQLWDU\VHZHUV\VWHPVKDOO EHREWDLQHGE\WKH&RQWUDFWRUXQOHVVSURYLGHGE\WKH'LVWULFW:DWHUVKDOOEHWUHDWHGSULRUWR GLVSRVDOLIVRVSHFLILHGLQWKH6SHFLDO3URYLVLRQVRUUHTXLUHGE\DSHUPLW 7KH&RQWUDFWRUVKDOOVXEPLWD'HZDWHULQJ3ODQDQGUHODWHGVXSSRUWLQJLQIRUPDWLRQGHWDLOLQJLWV SURSRVHG SODQ DQG PHWKRGRORJ\ RI GHZDWHULQJ WUHDWPHQWSUHWUHDWPHQW ZKHQ UHTXLUHG IRU SHUPLWFRPSOLDQFH DQGGLVSRVDORIDFFXPXODWHGZDWHU7KHSODQVKDOOLGHQWLI\WKHIROORZLQJ ORFDWLRQW\SHDQGVL]HRIGHZDWHULQJGHYLFHVDQGUHODWHGHTXLSPHQW VL]HDQGW\SHRIPDWHULDOVFRPSRVLQJWKHFROOHFWLRQV\VWHP VL]HDQGW\SHRIHTXLSPHQWWREHXVHGWRUHWDLQDQGLIUHTXLUHGWUHDWDFFXPXODWHGZDWHU WKHSURSRVHGGLVSRVDOORFDWLRQVDQG DQ\RWKHULQIRUPDWLRQUHTXLUHGE\WKHMXULVGLFWLRQDODJHQF\ ,I WKH SURSRVHG GLVSRVDO ORFDWLRQ LV D VDQLWDU\ VHZHU WKH &RQWUDFWRU VKDOO FRPSO\ ZLWK WKH 6SHFLDO8VH'LVFKDUJH3HUPLWIURPWKH(QFLQD:DVWHZDWHU$XWKRULW\,IWKHSURSRVHGGLVSRVDO ORFDWLRQLVDVWRUPGUDLQV\VWHPRUUHFHLYLQJERG\RIZDWHUWKH&RQWUDFWRUVKDOOVXEPLWZULWWHQ HYLGHQFHRISHUPLVVLRQIURPWKHRZQHURIWKHVWRUPGUDLQV\VWHPDQGLIQRWREWDLQHGE\WKH $JHQF\RULJLQDOVLJQHGSHUPLWVIURPMXULVGLFWLRQDOUHJXODWRU\DJHQFLHVRUZULWWHQHYLGHQFHWKDW VXFKSHUPLWVDUHQRWUHTXLUHG $OO FRVWV IRU GHZDWHULQJ LQFOXGLQJ VDPSOH FROOHFWLRQ WHVWLQJSHUPLW DSSOLFDWLRQ IHHV DQG LQVWDOODWLRQWHVWLQJDQGRSHUDWLRQRIWKHGHZDWHULQJV\VWHPVKDOOEHPDGHDWWKHFRQWUDFWSULFH VSHFLILHGLQWKHELGVFKHGXOHIRU'HZDWHULQJ,IQRVXFKELGLWHPLVOLVWHGSD\PHQWVKDOOEH FRQVLGHUHGLQFOXGHGLQWKHELGLWHPRIZRUNUHTXLULQJGHZDWHULQJDQGQRVHSDUDWHRUDGGLWLRQDO SD\PHQWVKDOOEHPDGHWKHUHIRU 'UDLQDJH&RQWURO7KH&RQWUDFWRUVKDOOPDLQWDLQGUDLQDJHZLWKLQDQGWKURXJKWKHZRUN DUHDV(DUWKGDPVZLOOQRWEHSHUPLWWHGLQSDYHGDUHDV7HPSRUDU\GDPVRIVDQGEDJVDVSKDOWLF FRQFUHWHRURWKHUDFFHSWDEOHPDWHULDOZLOOEHSHUPLWWHGZKHQQHFHVVDU\6XFKGDPVVKDOOEH UHPRYHGIURPWKHVLWHDVVRRQDVWKHLUXVHLVQRORQJHUQHFHVVDU\ 1RLVH &RQWURO $OO LQWHUQDO FRPEXVWLRQ HQJLQHV XVHG LQ WKH FRQVWUXFWLRQ VKDOOEH HTXLSSHGZLWKPXIIOHUVLQJRRGUHSDLUZKHQLQXVHRQWKHSURMHFWZLWKVSHFLDODWWHQWLRQWRWKH &LW\ 1RLVH &RQWURO 2UGLQDQFH &DUOVEDG 0XQLFLSDO &RGH &KDSWHU *HQHUDWRUV VKDOO EH VRXQGDWWHQXDWHGWRG%DDWIHHW 3527(&7,21$1'5(6725$7,212)(;,67,1*,03529(0(1767KH&RQWUDFWRU VKDOOEHUHVSRQVLEOHIRUWKHSURWHFWLRQRISXEOLFDQGSULYDWHSURSHUW\DGMDFHQWWRWKH:RUNDQG VKDOOH[HUFLVHGXHFDXWLRQWRDYRLGGDPDJHWRVXFKSURSHUW\ 7KH&RQWUDFWRUVKDOOUHSDLURUUHSODFHDOOH[LVWLQJLPSURYHPHQWVZLWKLQWKHULJKWRIZD\ZKLFK DUHQRWGHVLJQDWHGIRUUHPRYDO HJFXUEVVLGHZDONVGULYHZD\VIHQFHVZDOOVVLJQVXWLOLW\ LQVWDOODWLRQV SDYHPHQW VWUXFWXUHV HWF ZKLFK DUH GDPDJHG RUUHPRYHGDVDUHVXOWRILWV RSHUDWLRQV:KHQDSRUWLRQRIDVSULQNOHUV\VWHPZLWKLQWKHULJKWRIZD\PXVWEHUHPRYHGWKH UHPDLQLQJOLQHVVKDOOEHFDSSHG5HSDLUVDQGUHSODFHPHQWVVKDOOEHDWOHDVWHTXDOWRH[LVWLQJ LPSURYHPHQWVDQGVKDOOPDWFKWKHPLQILQLVKDQGGLPHQVLRQ 0DLQWHQDQFH RI VWUHHW DQG WUDIILF VLJQDOV\VWHPV WKDW DUH GDPDJHG WHPSRUDULO\ UHPRYHG RU UHORFDWHGVKDOOEHGRQHLQFRQIRUPDQFHZLWK Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 5HYLVHG&RQWUDFW1R$3DJHRI 7UHHVODZQVDQGVKUXEEHU\WKDWDUHQRWWREHUHPRYHGVKDOOEHSURWHFWHGIURPGDPDJHRU LQMXU\,IGDPDJHGRUUHPRYHGGXHWR&RQWUDFWRU¶VRSHUDWLRQVWKH\VKDOOEHUHVWRUHGRUUHSODFHG LQ DV QHDUO\ WKH RULJLQDO FRQGLWLRQ DQG ORFDWLRQ DV LV UHDVRQDEO\ SRVVLEOH /DZQV VKDOO EH UHVWRUHGZLWKVRGDQGXQSDYHGDUHDVFRYHUHGZLWKVXLWDEOHPXOFK 7KH&RQWUDFWRUVKDOOJLYHUHDVRQDEOHQRWLFHWRRFFXSDQWVRURZQHUVRIDGMDFHQWSURSHUW\WR SHUPLWWKHPWRVDOYDJHRUUHORFDWHSODQWVWUHHVIHQFHVVSULQNOHUVDQGRWKHULPSURYHPHQWV ZLWKLQWKHULJKWRIZD\ZKLFKDUHGHVLJQDWHGIRUUHPRYDODQGZRXOGEHGHVWUR\HGEHFDXVHRIWKH :RUN $OOFRVWVWRWKH&RQWUDFWRUIRUSURWHFWLQJUHPRYLQJDQGUHVWRULQJH[LVWLQJLPSURYHPHQWVVKDOO EHLQFOXGHGLQWKH%LG 3UHFRQVWUXFWLRQ6XUYH\7KH&RQWUDFWRUVKDOOSHUIRUPDSUHFRQVWUXFWLRQVXUYH\RIWKH SURMHFW VLWH WR SURYLGH D UHFRUG RI SUHFRQVWUXFWLRQ FRQGLWLRQV 7KLV VXUYH\ VKDOO LQFOXGH WKH IROORZLQJDVDPLQLPXP 9LGHRRIH[LVWLQJSXEOLFULJKWRIZD\RUHDVHPHQWVSURSRVHGDOLJQPHQWXWLOLW\PDUNRXWV ZRUNLQJDUHDVVWDJLQJDQGVWRUDJHDUHDV&RQGXFWWKHVXUYH\DIWHUFRQVWUXFWLRQVWDNLQJ KDVEHHQFRPSOHWHG 9LGHRRIFRQVWUXFWLRQDFFHVVURDGVWREHXVHGE\WKH&RQWUDFWRULQFOXGLQJDOOSXEOLFDQG SULYDWHVWUHHWVXVHGIRUDFFHVVWRDQGIURPWKHZRUNVLWH,QGLFDWHDUHDVRIGDPDJHG SDYLQJ $Q\RWKHUDUHDVDVGLUHFWHGE\WKH2ZQHUZKLFKPD\EHGLVWXUEHGRUZKLFKDUHWREH SURWHFWHGIURPWKH&RQWUDFWRU¶VRSHUDWLRQV 3KRWRJUDSKVDQGYLGHRRISRWHQWLDO³SUREOHPDUHDV´DQGSULYDWHSURSHUW\DGMDFHQWWRWKH :RUN 1RWLI\WKH2ZQHUVHYHQFDOHQGDUGD\VLQDGYDQFHDQGFRRUGLQDWHWKHVFKHGXOLQJRIWKH YLGHRVRWKDWDUHSUHVHQWDWLYHRIWKH2ZQHUPD\DFFRPSDQ\WKH&RQWUDFWRUGXULQJWKH YLGHRWDSLQJ $WWKHFRPSOHWLRQRIWKHVXUYH\WKH&RQWUDFWRUVKDOOSUHVHQWWKH2ZQHUZLWKDUHSRUW GHWDLOLQJWKHH[LVWLQJFRQGLWLRQVDWHDFKSURSRVHGSLSHOLQHVLWHVWDJLQJDQGVWRFNSLOH DUHDV7KHUHSRUWVKDOOLQFOXGHWKHIROORZLQJDVDPLQLPXP D 2QHFRS\RIWKHYLGHRLQFRORULQGLJLWDOIRUPDW E 2QHGLJLWDOSKRWRJUDSKRIHDFK³SRWHQWLDOSUREOHPDUHD´ F :ULWWHQVXPPDU\RI³SRWHQWLDOSUREOHPDUHDV´DQGWKH&RQWUDFWRU¶VUHFRPPHQGDWLRQV WRDGGUHVVWKHVHDUHDV 'RFXPHQWDWLRQ LQFOXGLQJ UHSRUW RI H[LVWLQJ FRQGLWLRQV VKDOO EH FRPSOHWHG ZLWKLQ GD\VRIWKH1RWLFHWR3URFHHG7KH&RQWUDFWRUZLOOQRWEHDOORZHGWREHJLQSRWKROLQJ H[FDYDWLRQ RU GHZDWHULQJ DFWLYLWLHV XQWLO WKH ILQDO UHSRUW KDVEHHQ VXEPLWWHG DQG DFFHSWHGE\WKH2ZQHU 38%/,&&219(1,(1&($1'6$)(7< 7UDIILF DQG $FFHVV 7KH &RQWUDFWRU¶V RSHUDWLRQV VKDOO FDXVH QR XQQHFHVVDU\ LQFRQYHQLHQFH 7KH DFFHVV ULJKWV RI WKH SXEOLF VKDOO EH FRQVLGHUHGDWDOOWLPHV8QOHVV RWKHUZLVHDXWKRUL]HGWUDIILFVKDOOEHSHUPLWWHGWRSDVVWKURXJKWKH:RUNRUDQDSSURYHGGHWRXU VKDOOEHSURYLGHG Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 5HYLVHG&RQWUDFW1R$3DJHRI ,Q DUHDV ZKHUH VLWH DFFHVV LV UHVWULFWHG WKH &RQWUDFWRU LV UHVSRQVLEOH IRU FRRUGLQDWLQJ VLWH DFFHVV $OO FRPPXQLFDWLRQV VKDOO EH PDGH WKURXJK WKH &LW\ LQVSHFWRU XQOHVV RWKHUZLVH DSSURYHG 1RH[FDYDWLRQRUYHKLFOHDFFHVVZLOOEHDOORZHGWRRFFXURXWVLGHRIWKHHDVHPHQWRXWVLGHRIWKH ULJKWRIZD\RULQYHJHWDWHGRUODQGVFDSHGDUHDVXQOHVVRWKHUZLVHVKRZQRQWKH3ODQVRUDV DSSURYHGE\WKH(QJLQHHU 6DIHDQGDGHTXDWHSHGHVWULDQDQGYHKLFXODUDFFHVVVKDOOEHSURYLGHGDQGPDLQWDLQHGWRILUH K\GUDQWV FRPPHUFLDODQGLQGXVWULDOHVWDEOLVKPHQWV FKXUFKHVVFKRROVDQGSDUNLQJORWV VHUYLFH VWDWLRQV DQG PRWHOV KRVSLWDOV SROLFH DQG ILUH VWDWLRQV SXEOLF WUDQVSRUWDWLRQ VWRSV DQG HVWDEOLVKPHQWVRIVLPLODUQDWXUH$FFHVVWRWKHVHIDFLOLWLHVVKDOOEHFRQWLQXRXVDQGXQREVWUXFWHG XQOHVVRWKHUZLVHDSSURYHGE\WKH(QJLQHHU3HGHVWULDQFURVVLQJVRIWKH:RUNDWLQWHUYDOVQRW H[FHHGLQJIHHW P VKDOOEHSURYLGHGDQGPDLQWDLQHGXQOHVVRWKHUZLVHDSSURYHGE\WKH (QJLQHHU 7KH&RQWUDFWRUVKDOOUHIHUWRDQGFRPSO\ZLWKWKHUHTXLUHPHQWVRI6HFWLRQDQG3DUWRI WKH6XSSOHPHQWDO3URYLVLRQV 6WRUDJHRI(TXLSPHQWDQG0DWHULDOVLQ3XEOLF6WUHHWV&RQVWUXFWLRQPDWHULDOVVKDOO QRWEHVWRUHGLQVWUHHWVURDGVRUKLJKZD\VDIWHUXQORDGLQJ&RQVWUXFWLRQHTXLSPHQWVKDOOQRWEH VWRUHG DW WKH :RUN VLWH EHIRUH LWV DFWXDO XVH RQ WKH :RUN RU DIWHU LW LV QR ORQJHU QHHGHG $OOPDWHULDOVRUHTXLSPHQWQRWLQVWDOOHGRUXVHGLQFRQVWUXFWLRQRQDQ\JLYHQGD\VKDOOEHVWRUHG HOVHZKHUHE\WKH&RQWUDFWRUDWLWVH[SHQVHXQOHVVRWKHUZLVHDSSURYHGE\WKH(QJLQHHU ([FDYDWHGPDWHULDOH[FHSWWKDWZKLFKLVWREHXVHGDVEDFNILOOLQWKHDGMDFHQWWUHQFKRQWKH VDPHGD\VKDOOQRWEHVWRUHGLQSXEOLFVWUHHWV$IWHUSODFLQJEDFNILOODOOH[FHVVPDWHULDOVKDOOEH UHPRYHGLPPHGLDWHO\IURPWKHVLWH 6WUHHW&ORVXUHV'HWRXUV%DUULFDGHV7KH&RQWUDFWRUVKDOOFRPSO\ZLWKDOODSSOLFDEOH 6WDWH&RXQW\DQG&LW\UHTXLUHPHQWVIRUFORVXUHRIVWUHHWV7KH &RQWUDFWRU VKDOO SURYLGH EDUULHUV JXDUGV OLJKWV VLJQV WHPSRUDU\ EULGJHV IODJ SHUVRQV DQG ZDWFKSHUVRQV 7KH &RQWUDFWRUVKDOOEHUHVSRQVLEOHIRUFRPSOLDQFHZLWKDGGLWLRQDOSXEOLFVDIHW\UHTXLUHPHQWVZKLFK PD\ DULVH 7KH &RQWUDFWRU VKDOO IXUQLVKDQG LQVWDOO VLJQV DQG ZDUQLQJGHYLFHVDQGSURPSWO\ UHPRYHWKHPXSRQFRPSOHWLRQRIWKH:RUN $IWHUREWDLQLQJWKH(QJLQHHUVDSSURYDODQGDWOHDVWZRUNLQJGD\VEHIRUHFORVLQJGHWRXULQJ SDUWLDOO\FORVLQJRUUHRSHQLQJDQ\VWUHHWDOOH\RURWKHUSXEOLFWKRURXJKIDUHWKH&RQWUDFWRUVKDOO QRWLI\WKHIROORZLQJ 7KH(QJLQHHU &DUOVEDG)LUH'HSDUWPHQW'LVSDWFK &DUOVEDG3ROLFH'HSDUWPHQW'LVSDWFK &DUOVEDG7UDIILF6LJQDOV0DLQWHQDQFH H[W &DUOVEDG7UDIILF6LJQDOV2SHUDWLRQV 1RUWK&RXQW\7UDQVLW'LVWULFW 5HSXEOLF6HUYLFHV 7KH&RQWUDFWRUVKDOOFRPSO\ZLWKWKHLUUHTXLUHPHQWV7KH&RQWUDFWRUVKDOOREWDLQWKH(QJLQHHU¶V ZULWWHQDSSURYDOSULRUWRGHYLDWLQJIURPWKHUHTXLUHPHQWVRI WKURXJKDQGLQFOXGLQJ DERYH Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 5HYLVHG&RQWUDFW1R$3DJHRI 7KH&RQWUDFWRUVKDOOREWDLQWKHZULWWHQDSSURYDOQROHVVWKDQILYHZRUNLQJGD\VSULRUWRSODFLQJ DQ\WUDIILFFRQWUROWKDWDIIHFWVEXVVWRSV 7KH&RQWUDFWRUVKDOOVHFXUHDSSURYDOLQDGYDQFHIURPDXWKRULWLHVFRQFHUQHGIRUWKHXVHRIDQ\ EULGJHVSURSRVHGE\LWIRUSXEOLFXVH7HPSRUDU\EULGJHVVKDOOEHFOHDUO\SRVWHGDVWRORDGOLPLW ZLWKVLJQVDQGSRVWLQJFRQIRUPLQJWRFXUUHQWUHTXLUHPHQWVFRYHULQJ³VLJQV´DVVHWIRUWKLQWKH 7UDIILF0DQXDOSXEOLVKHGE\WKH&DOLIRUQLD'HSDUWPHQWRI7UDQVSRUWDWLRQ7KLVPDQXDOVKDOODOVR DSSO\WRWKHVWUHHWFORVXUHVEDUULFDGHVGHWRXUVOLJKWVDQGRWKHUVDIHW\GHYLFHVUHTXLUHG $OOFRVWVLQYROYHGVKDOOEHLQFOXGHGLQWKH%LG 7HPSRUDU\WUDIILFFRQWUROVVKDOOEHLQDFFRUGDQFHZLWKWKH3ODQVWKH7&3WKH&DOLIRUQLD0DQXDO RQ8QLIRUP7UDIILF&RQWURO'HYLFHV 087&' FXUUHQWHGLWLRQDQGWKH&RQWUDFW'RFXPHQWV &RQVWUXFWLRQ$UHD 6LJQV DQG &RQWURO 'HYLFHV$OO FRQVWUXFWLRQ WUDIILF VLJQV DQG FRQWUROGHYLFHVVKDOOEHPDLQWDLQHGWKURXJKRXWWKHGXUDWLRQRIZRUNLQJRRGRUGHUDQGDFFRUGLQJ WRWKHDSSURYHGWUDIILFFRQWUROSODQ$OOWHPSRUDU\WUDIILFFRQWUROGHYLFHVVKDOOFRQIRUPWR&DOWUDQV 6WDQGDUG6SHFLILFDWLRQ :DUQLQJDQGDGYLVRU\VLJQVOLJKWVDQGGHYLFHVVKDOOEHIXUQLVKHGLQVWDOOHGDQGPDLQWDLQHGE\ WKH &RQWUDFWRU DQG VKDOO EH SURPSWO\ UHPRYHG E\ WKH &RQWUDFWRUZKHQ QR ORQJHU UHTXLUHG :DUQLQJDQGDGYLVRU\VLJQVWKDWUHPDLQLQSODFHRYHUQLJKWVKDOOEHVWDWLRQDU\PRXQWHGVLJQV 6WDWLRQDU\VLJQVWKDWZDUQRIQRQH[LVWHQWFRQGLWLRQVVKDOOEHUHPRYHGIURPWKHWUDYHOHGZD\ DQGIURPWKHYLHZRIPRWRULVWVLQWKHWUDYHOHGZD\RUVKLHOGHGIURPWKHYLHZRIWKHWUDYHOLQJ SXEOLFGXULQJVXFKSHULRGVWKDWWKHLUPHVVDJHGRHVQRWSHUWDLQWRH[LVWLQJFRQGLWLRQV $OOH[FDYDWLRQUHTXLUHGWRLQVWDOOVWDWLRQDU\FRQVWUXFWLRQDUHDVLJQVVKDOOEHSHUIRUPHGE\KDQG PHWKRGVZLWKRXWWKHXVHRISRZHUHTXLSPHQW:DUQLQJDQGDGYLVRU\VLJQVWKDWDUHXVHGRQO\ GXULQJZRUNLQJKRXUVPD\EHSRUWDEOHVLJQV3RUWDEOHVLJQVVKDOOEHUHPRYHGIURPWKHWUDYHOHG ZD\DQGVKLHOGHGIURPWKHYLHZRIWKHWUDYHOLQJSXEOLFGXULQJQRQZRUNLQJKRXUV 3HUVRQDOYHKLFOHVRIWKH&RQWUDFWRU VHPSOR\HHVVKDOOQRWEHSDUNHGZLWKLQWKHWUDYHOHGZD\ LQFOXGLQJDQ\6HFWLRQFORVHGWRSXEOLFWUDIILF:KHQHYHUWKH&RQWUDFWRU¶VYHKLFOHVRUHTXLSPHQW DUHSDUNHGRQWKHVKRXOGHUZLWKLQ¶RIDWUDIILFODQHWKHVKRXOGHUDUHDVKDOOEHFORVHGZLWK IOXRUHVFHQWWUDIILFFRQHVRUSRUWDEOHGHOLQHDWRUVSODFHGRQDWDSHU LQ DGYDQFH RI WKH SDUNHG YHKLFOHVRUHTXLSPHQWDQGDORQJWKHHGJHRIWKHSDYHPHQWDWQRWOHVVWKDQ¶LQWHUYDOVWRD SRLQW QRW OHVVWKDQ¶SDVWWKH ODVW YHKLFOHRU HTXLSPHQW$PLQLPXPRIQLQH FRQHVRU SRUWDEOHGHOLQHDWRUVVKDOOEHXVHGIRUWKHWDSHU$: 5RDG:RUN$KHDG RU& 6KRXOGHU :RUN$KHDG VLJQVKDOOEHPRXQWHGDVUHTXLUHGKHUHLQRQDVLJQSRVWRUWHOHVFRSLQJIODJWUHH ZLWKIODJV7KHVLJQSRVWRUIODJWUHHVKDOOEHSODFHGZKHUHGLUHFWHGE\WKH(QJLQHHU 0DLQWDLQLQJ7UDIILF7KH&RQWUDFWRU¶VSHUVRQQHOVKDOOQRWZRUNFORVHUWKDQP ¶ QRURSHUDWHHTXLSPHQWZLWKLQP ¶ IURPDQ\WUDIILFODQHRFFXSLHGE\WUDIILF)RUHTXLSPHQW WKHGLVWDQFHVKDOOEHPHDVXUHGIURPWKHFORVHVWDSSURDFKRIDQ\SDUWRIWKHHTXLSPHQWDVLWLV RSHUDWHGDQGRUPDQHXYHUHGLQSHUIRUPLQJWKHZRUN7KLVUHTXLUHPHQWPD\EHZDLYHGZKHQWKH (QJLQHHUKDVJLYHQZULWWHQDXWKRUL]DWLRQWRWKHUHGXFWLRQLQFOHDUDQFHWKDWLVVSHFLILFWRWKHWLPH GXUDWLRQDQGORFDWLRQRIVXFKZDLYHUZKHQVXFKUHGXFWLRQLVVKRZQRQWKHWUDIILFFRQWUROSODQV LQFOXGHGLQWKHVH&RQWUDFW'RFXPHQWVZKHQVXFKUHGXFWLRQLVVKRZQRQWKHWUDIILFFRQWUROSODQV SUHSDUHG E\ WKH &RQWUDFWRU DQG DSSURYHG E\ WKH (QJLQHHU RU IRUWKH ZRUN RI LQVWDOOLQJ PDLQWDLQLQJDQGUHPRYLQJWUDIILFFRQWUROGHYLFHV$VDFRQGLWLRQRIVXFKZDLYHUWKH(QJLQHHU Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 5HYLVHG&RQWUDFW1R$3DJHRI PD\UHTXLUHWKH&RQWUDFWRUWRGHWRXUWUDIILFDGMXVWWKHZLGWKRIRUUHDOLJQWKHDGMDFHQWWUDIILF ODQHFORVHWKHDGMDFHQWWUDIILFODQHRUSURYLGHEDUULHUV 'XULQJWKHHQWLUHFRQVWUXFWLRQDPLQLPXPRIRQHIRRWZLGHSDYHGWUDIILFODQHVKDOOEHRSHQ IRUXVHE\SXEOLFWUDIILFLQHDFKGLUHFWLRQRIWUDYHO 7UDIILF&RQWURO6\VWHPIRU/DQH&ORVXUH$WUDIILFFRQWUROV\VWHPFRQVLVWVRIFORVLQJ WUDIILF ODQHV RU SHGHVWULDQ ZDONZD\V LQ DFFRUGDQFH ZLWK WKH GHWDLOV VKRZQ RQ WKH SODQV &DOLIRUQLD 0DQXDO RQ 8QLIRUP 7UDIILF &RQWURO 'HYLFHV )+:$ 087&'FXUUHQWHGLWLRQDV DPHQGHGIRUXVHLQ&DOLIRUQLD DQGSURYLVLRQVXQGHU0DLQWDLQLQJ7UDIILFHOVHZKHUHLQWKHVH 3URYLVLRQV7KHSURYLVLRQVLQWKLVVHFWLRQZLOOQRWUHOLHYHWKH&RQWUDFWRUIURPLWVUHVSRQVLELOLW\WR SURYLGHVXFKDGGLWLRQDOGHYLFHVRUWDNHVXFKPHDVXUHVDVPD\EHQHFHVVDU\WRPDLQWDLQSXEOLF VDIHW\ :KHQODQHVDUHFORVHGIRURQO\WKHGXUDWLRQRIZRUNSHULRGVDOOFRPSRQHQWVRIWKHWUDIILFFRQWURO V\VWHPH[FHSWSRUWDEOHGHOLQHDWRUVSODFHGDORQJRSHQWUHQFKHVRUH[FDYDWLRQDGMDFHQWWRWKH WUDYHOHGZD\VKDOOEHUHPRYHGIURPWKHWUDYHOHGZD\DQGVKRXOGHUDWWKHHQGZRUNSHULRG ,IWKH &RQWUDFWRU VR HOHFWV VDLG FRPSRQHQWV PD\ EH VWRUHG DW VHOHFWHG FHQWUDO ORFDWLRQV DSSURYHGE\WKH(QJLQHHUZLWKLQWKHOLPLWVRIWKHULJKWRIZD\ 7UDIILF&RQWUROIRU3HUPDQHQWDQG7HPSRUDU\7UDIILF6WULSLQJ'XULQJWUDIILFVWULSLQJ RSHUDWLRQVWUDIILFVKDOOEHFRQWUROOHGZLWKODQHFORVXUHVDVSURYLGHGIRUXQGHU7UDIILF&RQWURO 6\VWHPIRU/DQH&ORVXUHRIWKHVH6XSSOHPHQWDO3URYLVLRQVRUE\XVHRIDQDOWHUQDWLYHWUDIILF FRQWUROSODQSURSRVHGE\WKH&RQWUDFWRUDQGDSSURYHGE\WKH(QJLQHHU7KH&RQWUDFWRUVKDOOQRW VWDUWWUDIILFVWULSLQJRSHUDWLRQVXVLQJDQDOWHUQDWLYHSODQXQWLOWKH&RQWUDFWRUKDVVXEPLWWHGLWV SODQWRWKH(QJLQHHUDQGKDVUHFHLYHGWKH(QJLQHHU VZULWWHQDSSURYDORIVDLGSODQ 7HPSRUDU\ 3DYHPHQW 'HOLQHDWLRQ 7HPSRUDU\ SDYHPHQW GHOLQHDWLRQ VKDOO EH IXUQLVKHG SODFHG PDLQWDLQHG DQG UHPRYHG LQ DFFRUGDQFH ZLWK WKH PLQLPXP VWDQGDUGV VSHFLILHG LQ WKH ODWHVW &DOLIRUQLD 0DQXDO RQ 8QLIRUP 7UDIILF &RQWURO 'HYLFHV &$087&' SXEOLVKHG E\ &DOWUDQV :KHQHYHU WKH ZRUN FDXVHV REOLWHUDWLRQ RI SDYHPHQW GHOLQHDWLRQ WHPSRUDU\RUSHUPDQHQWSDYHPHQWGHOLQHDWLRQVKDOOEHLQSODFHSULRUWRRSHQLQJWKHWUDYHOHG ZD\WRSXEOLFWUDIILF/DQHOLQHRUFHQWHUOLQHSDYHPHQWGHOLQHDWLRQVKDOOEHSURYLGHGDWDOOWLPHV IRU WUDYHOHG ZD\V RSHQ WR SXEOLF WUDIILF$OO ZRUN QHFHVVDU\ LQFOXGLQJ DQ\ UHTXLUHG OLQHV RU PDUNVWRHVWDEOLVKWKHDOLJQPHQWRIWHPSRUDU\SDYHPHQWGHOLQHDWLRQVKDOOEHSHUIRUPHGE\WKH &RQWUDFWRU :KHQ WHPSRUDU\ SDYHPHQW GHOLQHDWLRQ LV UHPRYHG DOO OLQHV DQG PDUNV XVHG WR HVWDEOLVKWKHDOLJQPHQWRIWKHWHPSRUDU\SDYHPHQWGHOLQHDWLRQVKDOOEHUHPRYHGE\JULQGLQJ 6XUIDFHVWR UHFHLYHWHPSRUDU\ SDYHPHQW GHOLQHDWLRQ VKDOO EH GU\ DQGIUHH RI GLUW DQG ORRVH PDWHULDO 7HPSRUDU\ SDYHPHQW GHOLQHDWLRQ VKDOO QRW EH DSSOLHG RYHU H[LVWLQJ SDYHPHQW GHOLQHDWLRQRURWKHUWHPSRUDU\SDYHPHQWGHOLQHDWLRQ7HPSRUDU\SDYHPHQWGHOLQHDWLRQVKDOOEH PDLQWDLQHGXQWLOVXSHUVHGHGRUUHSODFHGZLWKSHUPDQHQWSDYHPHQWGHOLQHDWLRQ 7HPSRUDU\SDYHPHQWGHOLQHDWLRQVKDOOEHUHPRYHGZKHQDVGHWHUPLQHGE\WKH(QJLQHHUWKH WHPSRUDU\SDYHPHQWGHOLQHDWLRQFRQIOLFWVZLWKWKHSHUPDQHQWSDYHPHQWGHOLQHDWLRQRUZLWKD QHZWUDIILFSDWWHUQIRUWKHDUHDDQGLVQRORQJHUUHTXLUHGIRUWKHGLUHFWLRQRISXEOLFWUDIILF:KHQ WHPSRUDU\SDYHPHQWGHOLQHDWLRQLVUHTXLUHGWREHUHPRYHGDOOOLQHVDQGPDUNVXVHGWRHVWDEOLVK WKHDOLJQPHQWRIWKHWHPSRUDU\SDYHPHQWGHOLQHDWLRQVKDOOEHUHPRYHG 3UHSDUDWLRQRI7UDIILF&RQWURO3ODQV7KH&RQWUDFWRUVKDOOVXEPLWWUDIILFFRQWUROSODQV 7&3V DVDSDUWRIWKH:RUNIRUDOOFRQVWUXFWLRQDFWLYLWLHVWKDWDUHORFDWHGZLWKLQWKHWUDYHOHG Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 5HYLVHG&RQWUDFW1R$3DJHRI ZD\7&3VVKDOOEHSUHSDUHGE\DSURIHVVLRQDOHQJLQHHUUHJLVWHUHGLQWKH6WDWHRI&DOLIRUQLDDQG UHJXODUO\HQJDJHGLQWKHSUHSDUDWLRQRIWUDIILFFRQWUROSODQV'HVLJQRI7&3VIRUFRQVWUXFWLRQ VKDOOPHHWWKHUHTXLUHPHQWVRIWKH&LW\DQGWKH&DOLIRUQLD0DQXDORQ8QLIRUP7UDIILF&RQWURO 'HYLFHVDVSXEOLVKHGE\&DOWUDQV6XEPLWWDODQGUHYLHZUHTXLUHPHQWVIRU7&3VVKDOOFRQIRUPWR 6HFWLRQ6KRS'UDZLQJVDQG6XEPLWWDOV 7KH&RQWUDFWRUPXVWREWDLQWKH(QJLQHHU¶VDSSURYDOSULRUWRLPSOHPHQWLQJ7&3V7KHPLQLPXP GD\UHYLHZSHULRGVSHFLILHGLQ6HFWLRQIRUVKRSGUDZLQJVDQGVXEPLWWDOVVKDOOSHUWDLQ WRHDFKVXEPLWWDORI7&3V1HZRUUHYLVHG7&3VXEPLWWDOVVKDOOLQFOXGHDOO7&3VQHHGHGIRUWKH HQWLUHGXUDWLRQRIWKH:RUN(DFK7&3SKDVHVKDOOEHSUHSDUHGLQVXIILFLHQWVFDOHDQGGHWDLOWR VKRZWKHODQHZLGWKVWUDQVLWLRQOHQJWKVFXUYHUDGLLVWDWLRQLQJRIIHDWXUHVDIIHFWLQJWKHWUDIILF FRQWUROSODQDQGWKHPHWKRGRORJ\SURSRVHGWRWUDQVLWLRQWRWKHVXEVHTXHQW7&3SKDVH:KHQ WKH YHUWLFDO DOLJQPHQW RI WKH WUDYHOHG VXUIDFH GLIIHUV IURP WKH ILQLVKHG SDYHPHQW HOHYDWLRQ YHUWLFDOFXUYHVPXVWDOVREHVKRZQ7KH(QJLQHHUVKDOOEHWKHVROHMXGJHRIWKHVXLWDELOLW\DQG TXDOLW\RIDQ\VXFK7&3V 3D\PHQW7KHFRQWUDFWSULFHSDLGIRU7UDIILF&RQWUROVKDOOLQFOXGHIXOOFRPSHQVDWLRQIRU IXUQLVKLQJ DOO ODERU PDWHULDOV WRROV HTXLSPHQW DQG LQFLGHQWDOV DQG IRU SHUIRUPLQJ DOO ZRUN LQYROYHGWRLPSOHPHQWWKHWUDIILFFRQWUROV\VWHPFRPSOHWHLQSODFHLQFOXGLQJEXWQRWOLPLWHGWR SUHSDULQJ DQG UHYLVLQJ7&3V IODJ SHUVRQV LQVWDOOLQJ WHPSRUDU\ RU SHUPDQHQW WUDIILF FRQWURO GHYLFHVVXFKDVEDUULHUVGHOLQHDWRUVOLJKWLQJVLJQDJHSRUWDEOHFKDQJHDEOHPHVVDJHVLJQV VWULSLQJSDYHPHQWPDUNHUVDQGPDUNLQJVLQDFFRUGDQFHZLWKWKH&RQWUDFW'RFXPHQWVDQGDV GLUHFWHGE\WKH(QJLQHHU3URJUHVVSD\PHQWVIRU7UDIILF&RQWUROZLOOEHEDVHGRQWKHSHUFHQWDJH RIWKHLPSURYHPHQWZRUNQHFHVVLWDWLQJWUDIILFFRQWURODQGFRPSOHWHG 6DIHW\ 6DIHW\2UGHUV7KH&RQWUDFWRUVKDOOKDYHDWWKH:RUNVLWHFRSLHVRUVXLWDEOHH[WUDFWV RI &RQVWUXFWLRQ 6DIHW\ 2UGHUV 7XQQHO 6DIHW\ 2UGHUV DQG *HQHUDO ,QGXVWU\ 6DIHW\ 2UGHUV LVVXHGE\WKH6WDWH'LYLVLRQRI,QGXVWULDO6DIHW\7KH&RQWUDFWRUVKDOOFRPSO\ZLWKSURYLVLRQVRI WKHVHDQGDOORWKHUDSSOLFDEOHODZVRUGLQDQFHVDQGUHJXODWLRQV %HIRUHH[FDYDWLQJDQ\WUHQFKIHHWRUPRUHLQGHSWKWKH&RQWUDFWRUVKDOOVXEPLWDGHWDLOHGSODQ WRWKH$JHQF\VKRZLQJWKHGHVLJQRIVKRULQJEUDFLQJVORSLQJRURWKHUSURYLVLRQVWREHPDGH IRUWKHZRUNHUV¶SURWHFWLRQIURPWKHKD]DUGRIFDYLQJJURXQGGXULQJWKHH[FDYDWLRQRIVXFK WUHQFK,IWKHSODQYDULHVIURPWKHVKRULQJV\VWHPVWDQGDUGVWKHSODQVKDOOEHSUHSDUHGE\D UHJLVWHUHG&LYLO(QJLQHHU1RH[FDYDWLRQVKDOOVWDUWXQWLOWKH(QJLQHHUKDVDFFHSWHGWKHSODQDQG WKH&RQWUDFWRUKDVREWDLQHGDSHUPLWIURPWKH6WDWH'LYLVLRQRI,QGXVWULDO6DIHW\$FRS\RIWKH SHUPLWVKDOOEHVXEPLWWHGWRWKH(QJLQHHU 3D\PHQWIRUSHUIRUPLQJDOOZRUNQHFHVVDU\WRSURYLGHVDIHW\PHDVXUHVVKDOOEHLQFOXGHGLQWKH SULFHVELGIRURWKHULWHPVRIZRUNH[FHSWZKHUHVHSDUDWHELGLWHPVIRUH[FDYDWLRQVDIHW\DUH SURYLGHGRUUHTXLUHGE\ODZ 8VHRI([SORVLYHV([SORVLYHVPD\EHXVHGRQO\ZKHQDXWKRUL]HGLQZULWLQJE\WKH (QJLQHHURUDVRWKHUZLVHVWDWHGLQWKH6SHFLILFDWLRQV([SORVLYHVVKDOOEHKDQGOHGXVHGDQG VWRUHGLQDFFRUGDQFHZLWKDOODSSOLFDEOHUHJXODWLRQV 7KH(QJLQHHU¶VDSSURYDORIWKHXVHRIH[SORVLYHVVKDOOQRWUHOLHYHWKH&RQWUDFWRUIURPOLDELOLW\IRU FODLPVFDXVHGE\EODVWLQJRSHUDWLRQV Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 5HYLVHG&RQWUDFW1R$3DJHRI 6SHFLDO+D]DUGRXV6XEVWDQFHVDQG3URFHVVHV0DWHULDOVWKDWFRQWDLQKD]DUGRXV VXEVWDQFHV RU PL[WXUHV PD\ EH UHTXLUHG RQ WKH :RUN $ 0DWHULDO6DIHW\ 'DWD 6KHHW DV GHVFULEHG LQ 6HFWLRQ RI WKH &DOLIRUQLD &RGH RI 5HJXODWLRQV VKDOO EH UHTXHVWHG E\ WKH &RQWUDFWRUIURPWKHPDQXIDFWXUHURIDQ\KD]DUGRXVSURGXFWVXVHG 0DWHULDOXVDJHVKDOOEHDFFRPSOLVKHGZLWKVWULFWDGKHUHQFHWR&DOLIRUQLD'LYLVLRQRI,QGXVWULDO 6DIHW\UHTXLUHPHQWVDQGDOOPDQXIDFWXUHUZDUQLQJVDQGDSSOLFDWLRQLQVWUXFWLRQVOLVWHGRQWKH 0DWHULDO6DIHW\'DWD6KHHWDQGRQWKHSURGXFWFRQWDLQHUODEHO 7KH &RQWUDFWRU VKDOO QRWLI\ WKH (QJLQHHU LI D VSHFLILHG SURGXFW FDQQRW EH XVHG XQGHU VDIH FRQGLWLRQV &RQILQHG6SDFHV D &RQILQHG 6SDFH (QWU\ 3URJUDP 7KH &RQWUDFWRU VKDOO EH UHVSRQVLEOH IRU LPSOHPHQWLQJ DGPLQLVWHULQJ DQG PDLQWDLQLQJ D FRQILQHG VSDFH HQWU\ SURJUDP &6(3 LQ DFFRUGDQFH ZLWK 6HFWLRQVDQG7LWOH&&5 3ULRUWRVWDUWLQJWKH:RUNWKH&RQWUDFWRUVKDOOSUHSDUHDQGVXEPLWLWVFRPSUHKHQVLYH&6(3WR WKH(QJLQHHU7KH&6(3VKDOODGGUHVVDOOSRWHQWLDOSK\VLFDODQGHQYLURQPHQWDOKD]DUGVDQG FRQWDLQSURFHGXUHVIRUVDIHHQWU\LQWRFRQILQHGVSDFHVLQFOXGLQJEXWQRWOLPLWHGWRWKHIROORZLQJ 7UDLQLQJRISHUVRQQHO 3XUJLQJDQGFOHDQLQJWKHVSDFHRIPDWHULDOVDQGUHVLGXH 3RWHQWLDOLVRODWLRQDQGFRQWURORIHQHUJ\DQGPDWHULDOLQIORZ &RQWUROOHGDFFHVVWRWKHVSDFH $WPRVSKHULFWHVWLQJRIWKHVSDFH 9HQWLODWLRQRIWKHVSDFH 6SHFLDOKD]DUGVFRQVLGHUDWLRQ 3HUVRQDOSURWHFWLYHHTXLSPHQW 5HVFXHSODQSURYLVLRQV 7KH &RQWUDFWRU¶V VXEPLWWDO VKDOO LQFOXGH WKH QDPHV RI LWV SHUVRQQHO LQFOXGLQJ VXEFRQWUDFWRU SHUVRQQHODVVLJQHGWRWKHSURMHFWZKRZLOOKDYH&6(3UHVSRQVLELOLWLHVWKHLU&6(3WUDLQLQJDQG WKHLUVSHFLILFDVVLJQPHQWDQGUHVSRQVLELOLW\LQFDUU\LQJRXWWKH&6(3 E 3HUPLW5HTXLUHG&RQILQHG6SDFHV(QWU\LQWRSHUPLWUHTXLUHGFRQILQHGVSDFHVDVGHILQHGLQ 6HFWLRQ7LWOH&&5PD\EHUHTXLUHGDVDSDUWRIWKH:RUN$OOPDQKROHVWDQNVYDXOWV SLSHOLQHV H[FDYDWLRQV RU RWKHU HQFORVHG RU SDUWLDOO\ HQFORVHG VSDFHV VKDOO EH FRQVLGHUHG SHUPLWUHTXLUHG FRQILQHG VSDFHV XQWLO WKH SUHHQWU\ SURFHGXUHVGHPRQVWUDWH RWKHUZLVH 7KH &RQWUDFWRUVKDOOLPSOHPHQWDSHUPLWVSDFHSURJUDPSULRUWRSHUIRUPLQJDQ\ZRUNLQDSHUPLW UHTXLUHG FRQILQHG VSDFH $ FRS\ RI WKH SHUPLW VKDOO EH DYDLODEOHDWDOOWLPHVIRUUHYLHZE\ &RQWUDFWRUDQG$JHQF\SHUVRQQHODWWKH:RUNVLWH F 3D\PHQW3D\PHQWIRULPSOHPHQWLQJDGPLQLVWHULQJDQGSURYLGLQJ DOO HTXLSPHQW DQG SHUVRQQHO WR SHUIRUP WKH &6(3 VKDOO EH LQFOXGHG LQ WKH ELG LWHPV IRU ZKLFK WKH &6(3 LV UHTXLUHG 6DIHW\ DQG 3URWHFWLRQ RI :RUNHUV DQG 3XEOLF 7KH &RQWUDFWRU VKDOO WDNH DOO QHFHVVDU\ SUHFDXWLRQV IRU WKH VDIHW\ RI HPSOR\HHV RQ WKH ZRUN DQG VKDOO FRPSO\ ZLWK DOO DSSOLFDEOHSURYLVLRQVRI)HGHUDO6WDWHDQG0XQLFLSDOVDIHW\ODZVDQGEXLOGLQJFRGHVWRSUHYHQW DFFLGHQWVRULQMXU\WRSHUVRQVRQDERXWRUDGMDFHQWWRWKHSUHPLVHVZKHUHWKHZRUNLVEHLQJ Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 5HYLVHG&RQWUDFW1R$3DJHRI SHUIRUPHG7KH&RQWUDFWRUVKDOOHUHFWDQGSURSHUO\PDLQWDLQDWDOOWLPHVDVUHTXLUHGE\WKH FRQGLWLRQVDQGSURJUHVVRIWKHZRUNDOOQHFHVVDU\VDIHJXDUGVIRUWKHSURWHFWLRQRIZRUNHUVDQG SXEOLF DQG VKDOO XVH GDQJHU VLJQV ZDUQLQJ DJDLQVW KD]DUGV FUHDWHG E\ VXFK IHDWXUHV RI FRQVWUXFWLRQDVSURWUXGLQJQDLOVKRLVWVZHOOKROHVDQGIDOOLQJPDWHULDOV )ORRG/LJKWLQJ *HQHUDO:KHQZRUNLVEHLQJSHUIRUPHGGXULQJKRXUVRIGDUNQHVVDVGHILQHGLQ 'LYLVLRQ6HFWLRQRIWKH&DOLIRUQLD9HKLFOH&RGHIORRGOLJKWLQJVKDOOEHXVHGWRLOOXPLQDWH WKH:RUNVLWHIODJJHUVWDWLRQVHTXLSPHQWFURVVLQJVDQGRWKHUKD]DUGRXVDUHDV)ORRGOLJKWLQJ VKDOOSURYLGHYLVLELOLW\IRUDGLVWDQFHRIPLOH P )ORRGOLJKWVVKDOOQRWVKLQHGLUHFWO\LQWR WKHYLHZRIRQFRPLQJWUDIILF 3D\PHQW1RVHSDUDWHRUDGGLWLRQDOSD\PHQWZLOOEHPDGHIRUIORRGOLJKWLQJ3D\PHQW VKDOOEHLQFOXGHGLQWKH&RQWUDFW8QLW3ULFHRUOXPSVXPSULFHLQWKH%LGIRUWKHYDULRXV%LG LWHPV 6HFXULW\DQG3URWHFWLYH'HYLFHV *HQHUDO6HFXULW\DQGSURWHFWLYHGHYLFHVVKDOOFRQVLVWRIIHQFLQJVWHHOSODWHVRU RWKHUGHYLFHVDVVSHFLILHGLQWKH6SHFLDO3URYLVLRQVWRSURWHFWRSHQH[FDYDWLRQV 6HFXULW\)HQFLQJ7KH&RQWUDFWRUVKDOOFRPSOHWHO\IHQFHRSHQH[FDYDWLRQV6HFXULW\ IHQFLQJ VKDOO FRQIRUP WR 6HFXULW\ IHQFLQJ VKDOO UHPDLQ LQ SODFH XQOHVV ZRUNHUV DUH SUHVHQW DQG FRQVWUXFWLRQ RSHUDWLRQV DUH LQ SURJUHVV GXULQJ ZKLFK WLPH WKH &RQWUDFWRU VKDOO SURYLGHHTXLYDOHQWVHFXULW\ 3D\PHQW1RVHSDUDWHRUDGGLWLRQDOSD\PHQWZLOOEHPDGHIRUVHFXULW\IHQFLQJRU SURWHFWLYHGHYLFHV3D\PHQWVKDOOEHLQFOXGHGLQWKH&RQWUDFW8QLW3ULFHRUOXPSVXPSULFHLQ WKH%LGIRUWKHYDULRXV%LGLWHPV 6WHHO3ODWH&RYHUV *HQHUDO7KH&RQWUDFWRUVKDOOSURYLGHLQVWDOODQGPDLQWDLQVWHHOSODWHFRYHUVDV QHFHVVDU\WR SURWHFW IURP DFFLGHQWDO HQWU\ LQWRRSHQLQJVWUHQFKHV DQG H[FDYDWLRQV 3ODWHV VKDOOSURYLGHFRPSOHWHFRYHUDJHWRSUHYHQWDQ\SHUVRQELF\FOHPRWRUF\FOHRUPRWRUYHKLFOH IURPEHLQJHQGDQJHUHGGXHWRSODWHPRYHPHQWFDXVLQJVHSDUDWLRQVRUJDSV7KH&RQWUDFWRU VKDOO VXEPLW WKH GHVLJQ LQ DFFRUGDQFH ZLWK 6HFWLRQ ZKLFKVKDOO LQFOXGH WKH IROORZLQJ FULWHULD 7KHDSSURYDORIVWHHOSODWHEULGJLQJVKDOOEHDWWKHVROHGLVFUHWLRQRIWKH(QJLQHHU 6WHHOSODWHEULGJLQJVKDOOEHGHVLJQHGWRVXSSRUW+6WUXFNORDGLQJSHU&DOWUDQV %ULGJH'HVLJQ6SHFLILFDWLRQV0DQXDO 6XUIDFHVH[SRVHGWRSHGHVWULDQRUYHKLFXODUWUDIILFVKDOOEHQRQVNLG7KH&RQWUDFWRU VKDOO PDLQWDLQ D QRQVNLG VXUIDFHRQWKH VWHHOSODWH KDYLQJ D PLQLPXP FRHIILFLHQW RI IULFWLRQHTXLYDOHQWWRDVGHWHUPLQHGE\&DOLIRUQLD7HVW0HWKRG,IDGLIIHUHQWWHVW PHWKRGLVXVHGWKH&RQWUDFWRUPD\XWLOL]HVWDQGDUGWHVWSODWHVZLWKNQRZQFRHIILFLHQWV RI IULFWLRQ DYDLODEOH IURP HDFK &DOWUDQV 'LVWULFW 0DWHULDOV (QJLQHHUWRFRUUHODWHVNLG UHVLVWDQFHUHVXOWVWR&DOLIRUQLD7HVW0HWKRG Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 5HYLVHG&RQWUDFW1R$3DJHRI 7KH &RQWUDFWRU VKDOO LQVWDOO VLJQDJH ZLWK D LQFK PP PLQLPXP OHWWHU KHLJKW LQGLFDWLQJ WKH VWHHO SODWH FRYHU ORDG OLPLW WKH &RPSDQ\¶V QDPH DQG D KRXU HPHUJHQF\FRQWDFWSKRQHQXPEHU7KH &RQWUDFWRU VKDOO LQVWDOO 5RXJK 5RDG : VLJQ ZLWK EODFN OHWWHULQJ RQ DQ RUDQJH EDFNJURXQGLQDGYDQFHRIVWHHOSODWHEULGJLQJ 7KH&RQWUDFWRULVUHVSRQVLEOHIRUWKHPDLQWHQDQFHRIWKHSODWHVDQGDVSKDOWFRQFUHWH UDPSVRURWKHUGHYLFHVXVHGWRVHFXUHWKHSODWHVDQGVKRULQJRIWKHWUHQFKWRVXSSRUWDOO ORDGV &RQWUDFWRU VKDOO LPPHGLDWHO\ PRELOL]H QHFHVVDU\ SHUVRQQHO DQG HTXLSPHQW WR UHSDLU SODWH PRYHPHQWVVHSDUDWLRQ QRLVHDQFKRUVDVSKDOWUDPSVRUDQ\ RWKHU GHILFLHQF\ )DLOXUHWRUHVSRQGZLWKLQKRXUVDIWHUEHLQJQRWLILHGE\WKH(QJLQHHUVKDOOEHJURXQGV IRUWKH&LW\WRSHUIRUPQHFHVVDU\UHSDLUVDWWKHH[SHQVHRIWKH&RQWUDFWRU :KHQSODWHVDUHUHPRYHGWKHSDYHPHQWVXUIDFHVKDOOEHUHSDLUHGWRWKHVDWLVIDFWLRQRI WKH(QJLQHHU )RU WUHQFK ZLGWKV H[FHHGLQJ WKRVH LQ 7DEOH D VWUXFWXUDO GHVLJQ VKDOO EH SUHSDUHGE\D&DOLIRUQLDUHJLVWHUHGFLYLORUVWUXFWXUDOHQJLQHHUUHJXODUO\HQJDJHGLQWKH GHVLJQRIVKRULQJV\VWHPV 7KLFNQHVV6WHHOSODWHFRYHUVVKDOOFRQIRUPWR7DEOH 7$%/( 7UHQFK:LGWK6WHHO3ODWH&RYHU7KLFNQHVV /HVVWKDQ PP PP WR PP PP PP WR PP PP PP WR PP PP PP WR PP PP 0RUHWKDQ PP 6HH1RWH 1RWHV 7KH&RQWUDFWRUVKDOOVXEPLWD:RUNLQJ'UDZLQJDQGFDOFXODWLRQVEDVHGRQ$$6+72+EULGJHORDGLQJ ,QVWDOODWLRQ6WHHOSODWHFRYHUVVKDOOH[WHQGDPLQLPXPRIIHHW PP EH\RQG WUHQFKHGJHV8QOHVVRWKHUZLVHVSHFLILHGLQWKH6SHFLDO3URYLVLRQVRUDSSURYHGE\WKH(QJLQHHU IRUWKHVLWHFRQGLWLRQVSULRUWRXVHVWHHOSODWHFRYHUVVKDOOEHLQVWDOOHGXVLQJ0HWKRG0HWKRG VKDOOQRWEHXVHGLQDWUDYHOHGODQH 0HWKRG7KHSDYHPHQWVKDOOEHFROGPLOOHGWRDGHSWKHTXDOWRWKHWKLFNQHVVRIWKHSODWH DQG WR D ZLGWK DQG OHQJWK HTXDO WR WKH GLPHQVLRQV RI WKH SODWH 7KH FROG PLOOLQJ VKDOO SURGXFH D IODW VXUIDFH WR VXSSRUW WKH SODWH ZLWK QR KRUL]RQWDORU YHUWLFDO PRYHPHQW +RUL]RQWDOJDSVEHWZHHQWKHXQPLOOHGSDYHPHQWDQGWKHSODWHVKDOOQRWH[FHHGLQFK PP DQGVKDOOEHILOOHGZLWKHODVWRPHULFVHDODQWPDWHULDOZKLFKPD\DWWKH &RQWUDFWRU¶V RSWLRQEHPL[HGZLWKQRPRUHWKDWE\YROXPHRI7\SH,DJJUHJDWHFRQIRUPLQJWRWKH UHTXLUHPHQWVRI7DEOHV % DQG $ 0HWKRG7KHDSSURDFKSODWHDQGHQGLQJSODWH LQORQJLWXGLQDOSODFHPHQW VKDOOEHDWWDFKHG WRWKHVXUIDFHE\DPLQLPXPRIGRZHOVô´GLDPHWHU PP GULOOHGDWWKHFRUQHUVRIWKH SODWHDQGGULOOHGLQFKHV PP LQWRWKHSDYHPHQW6XEVHTXHQWSODWHVPD\EHEXWWHG QH[WWRHDFKRWKHU7HPSRUDU\DVSKDOWFRQFUHWH '6& VKDOOEHXVHGWRFRQVWUXFW WDSHUVIURPWKHVWHHOSODWHVXUIDFHWRWKHH[LVWLQJVXUIDFHDWDLQFK PP UXQIRUHDFK LQFK PP WKLFNQHVVRIVWHHOSODWH:KHQVWHHOSODWHVDUHUHPRYHGWKHGRZHOKROHVLQ WKHSDYHPHQWVHFWLRQVKDOOEHFRPSOHWHO\ILOOHGZLWKHODVWRPHULFVHDODQWPDWHULDO Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 5HYLVHG&RQWUDFW1R$3DJHRI $GYDQFHWUDIILFZDUQLQJVLJQVVKDOOEHLQVWDOOHGDVVSHFLILHGLQWKH6SHFLDO3URYLVLRQVRUVKRZQ RQWKH7&3 3D\PHQW 6WHHO SODWH EULGJLQJ PDWHULDOV LQFOXGLQJ EXW QRW OLPLWHG WR VWHHOSODWHV DQFKRULQJ GHYLFHV FROG PLOOLQJ HODVWRPHULF VHDODQW PDWHULDODVSKDOW UDPSLQJ DQG SDGGLQJ VLJQDJHSODFLQJLQVWDOODWLRQUHPRYDOUHORFDWLRQSUHSDUDWLRQDQGSURFHVVLQJRIVKRSGUDZLQJV DQG VXEPLWWDOV WR VXSSRUW WKH XVH RI VWHHO SODWH EULGJLQJ DQG DOO RWKHU PDWHULDOV ODERU VXSHUYLVLRQRYHUKHDGRIDQ\W\SHRUGHVFULSWLRQZLOOEHFRQVLGHUHGDVLQFLGHQWDOWRWKHZRUN1R VHSDUDWHRUDGGLWLRQDOSD\PHQWIRUVWHHOSODWHEULGJLQJZLOOEHPDGH1RH[WHQVLRQWRFRQWUDFW WLPHZLOOEHDOORZHGIRURUEHFDXVHRIWKHXVHRIVWHHOSODWHEULGJLQJ 3$7(17)((62552<$/7,(67KH&RQWUDFWRUVKDOODEVRUELQLWV%LGWKHSDWHQWIHHV RUUR\DOWLHVRQDQ\SDWHQWHGDUWLFOHRUSURFHVVIXUQLVKHGRUXVHGLQWKH:RUN7KH&RQWUDFWRU VKDOOLQGHPQLI\DQGKROGWKH$JHQF\KDUPOHVVIURPDQ\OHJDODFWLRQWKDWPD\EHEURXJKWIRU LQIULQJHPHQWRISDWHQWV $'9(57,6,1*7KHQDPHVDGGUHVVHVDQGVSHFLDOWLHVRI&RQWUDFWRUV6XEFRQWUDFWRUV DUFKLWHFWVRUHQJLQHHUVPD\EHGLVSOD\HGRQUHPRYDEOHVLJQV7KHVL]HDQGORFDWLRQVKDOOEH VXEMHFWWRWKH(QJLQHHU¶VDSSURYDO &RPPHUFLDODGYHUWLVLQJPDWWHUVKDOOQRWEHDWWDFKHGWRRUSDLQWHGRQWKHVXUIDFHVRIEXLOGLQJV IHQFHVFDQRSLHVRUEDUULFDGHV /$:6 72 %( 2%6(59(' 7KH &RQWUDFWRU VKDOO NHHS IXOO\ LQIRUPHG RI 6WDWH DQG 1DWLRQDOODZVDQG&RXQW\DQG0XQLFLSDORUGLQDQFHVDQGUHJXODWLRQVZKLFKLQDQ\PDQQHUDIIHFW WKRVHHPSOR\HGLQWKH:RUNRUWKHPDWHULDOVXVHGLQWKH:RUNRULQDQ\ZD\DIIHFWWKHFRQGXFW RIWKH:RUN7KH&RQWUDFWRUVKDOODWDOOWLPHVREVHUYHDQGFRPSO\ZLWKVXFKODZVRUGLQDQFHV DQGUHJXODWLRQV0XQLFLSDORUGLQDQFHVWKDWDIIHFWWKLVZRUNLQFOXGH&KDSWHU([FDYDWLRQ DQG*UDGLQJ,IWKLVQRWLFHVSHFLILHVORFDWLRQVRUSRVVLEOHPDWHULDOVVXFKDVERUURZSLWVRU JUDYHOEHGVIRUXVHLQWKHSURSRVHGFRQVWUXFWLRQSURMHFWZKLFKZRXOGEHVXEMHFWWR6HFWLRQ RU 6HFWLRQ RI WKH )LVK DQG *DPH &RGH WKH FRQGLWLRQVHVWDEOLVKHG SXUVXDQW WR 6HFWLRQHWVHTRIWKH)LVKDQG*DPH&RGHVKDOOEHFRPHFRQGLWLRQVRIWKHFRQWUDFW $17,75867&/$,066HFWLRQRIWKH3XEOLF&RQWUDFW&RGHSURYLGHV ³,Q HQWHULQJ LQWR D SXEOLF ZRUNV FRQWUDFW RU D VXEFRQWUDFW WR VXSSO\ JRRGV VHUYLFHV RU PDWHULDOV SXUVXDQW WR D SXEOLF ZRUNV FRQWUDFW WKH FRQWUDFWRU RU VXEFRQWUDFWRURIIHUVDQGDJUHHVWRDVVLJQWRWKHDZDUGLQJERG\DOOULJKWVWLWOH DQGLQWHUHVWLQDQGWRDOOFDXVHVRIDFWLRQLWPD\KDYHXQGHU6HFWLRQRIWKH &OD\WRQ$FW 86&6HF RU&DUWZULJKW$FW &KDSWHU>FRPPHQFLQJZLWK 6HFWLRQ@RI3DUWRI'LYLVLRQRIWKH%XVLQHVVDQG3URIHVVLRQV&RGH DULVLQJIURPSXUFKDVHVRIJRRGVVHUYLFHVRUPDWHULDOVSXUVXDQWWRWKHSXEOLF ZRUNV FRQWUDFW RU VXEFRQWUDFW 7KH DVVLJQPHQW VKDOO EH PDGH DQGEHFRPH HIIHFWLYHDWWKHWLPHWKHDZDUGLQJERG\WHQGHUVILQDOSD\PHQWWRWKHFRQWUDFWRU ZLWKRXWIXUWKHUDFNQRZOHGJPHQWRIWKHSDUWLHV´ Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 5HYLVHG&RQWUDFW1R$3DJH RI 6(&7,21±)$&,/,7,(6)25$*(1&<3(56211(/ *(1(5$/)LHOG)DFLOLWLHVIRU$JHQF\SHUVRQQHODUHQRWUHTXLUHG Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 5HYLVHG&RQWUDFW1R$3DJHRI 6(&7,21 ±0($685(0(17$1'3$<0(17 0($685(0(172)48$17,7,(6)2581,735,&(:25. *HQHUDO 8QOHVV RWKHUZLVH VSHFLILHG TXDQWLWLHV RI ZRUN VKDOO EH GHWHUPLQHG IURP PHDVXUHPHQWVRUGLPHQVLRQVLQKRUL]RQWDOSODQHV+RZHYHUOLQHDUTXDQWLWLHVRISLSHSLOLQJ IHQFLQJDQGWLPEHUVKDOOEHFRQVLGHUHGDVEHLQJWKHWUXHOHQJWKPHDVXUHGDORQJORQJLWXGLQDO D[LV 8QOHVVRWKHUZLVHSURYLGHGLQ6SHFLILFDWLRQVYROXPHWULFTXDQWLWLHVVKDOOEHWKHSURGXFWRIWKH PHDQDUHDRIYHUWLFDORUKRUL]RQWDOVHFWLRQVDQGWKHLQWHUYHQLQJKRUL]RQWDORUYHUWLFDOGLPHQVLRQ 7KHSODQLPHWHUVKDOOEHFRQVLGHUHGDQLQVWUXPHQWRISUHFLVLRQDGDSWHGWRPHDVXUHPHQWRIDOO DUHDV 0HWKRGVRI0HDVXUHPHQW0DWHULDOVDQGLWHPVRIZRUNZKLFKDUHWREHSDLGIRURQ EDVLV RI PHDVXUHPHQW VKDOO EH PHDVXUHG LQ DFFRUGDQFH ZLWK PHWKRGV VWLSXODWHG LQ WKH SDUWLFXODUVHFWLRQVLQYROYHG &HUWLILHG:HLJKWV:KHQSD\PHQWLVWREHPDGHRQWKHEDVLVRIZHLJKWWKHZHLJKLQJ VKDOOEHGRQHRQFHUWLILHGSODWIRUPVFDOHVRUZKHQDSSURYHGE\WKH(QJLQHHURQDFRPSOHWHO\ DXWRPDWHG ZHLJKLQJ DQG UHFRUGLQJ V\VWHP 7KH &RQWUDFWRU VKDOO IXUQLVK WKH (QJLQHHU ZLWK GXSOLFDWH OLFHQVHG ZHLJKPDVWHU¶VFHUWLILFDWHV VKRZLQJ DFWXDO QHW ZHLJKWV 7KH $JHQF\ ZLOO DFFHSWWKHFHUWLILFDWHVDVHYLGHQFHRIZHLJKWVGHOLYHUHG 8QLWV RI 0HDVXUHPHQW 7KH V\VWHP RI PHDVXUH IRU WKLV FRQWUDFW VKDOO EH WKH 86 6WDQGDUG0HDVXUHV /803680:25. ,WHPV IRU ZKLFK TXDQWLWLHV DUH LQGLFDWHG³/XPS 6XP´ ³/6´ RU ³-RE´ VKDOO EH SDLG IRU DW WKH SULFH LQGLFDWHG LQ WKH %LG 6XFK SD\PHQW VKDOO EH IXOO FRPSHQVDWLRQIRUWKHLWHPVRIZRUNDQGDOOZRUNDSSXUWHQDQWWKHUHWR 7KH&RQWUDFWRUVKDOOVXEPLWWRWKH(QJLQHHUZLWKLQGD\VDIWHUDZDUGRI&RQWUDFWDGHWDLOHG VFKHGXOHLQWULSOLFDWHWREHXVHGDVDEDVLVIRUGHWHUPLQLQJSURJUHVVSD\PHQWVRQDOXPSVXP FRQWUDFWRUGHVLJQDWHGOXPSVXPELGLWHP7KLVVFKHGXOHVKDOOHTXDOWKHOXPSVXPELGDQGVKDOO EHLQVXFKIRUPDQGVXIILFLHQWO\GHWDLOHGDVWRVDWLVI\WKH(QJLQHHUWKDWLWFRUUHFWO\UHSUHVHQWVD UHDVRQDEOHDSSRUWLRQPHQWRIWKHOXPSVXP 3$<0(17 *HQHUDO 7KH TXDQWLWLHV OLVWHG LQ WKH %LG VFKHGXOH ZLOO QRW JRYHUQ ILQDO SD\PHQW 3D\PHQWWRWKH&RQWUDFWRUZLOOEHPDGHRQO\IRUDFWXDOTXDQWLWLHVRI&RQWUDFWLWHPVFRQVWUXFWHG LQDFFRUGDQFHZLWKWKH3ODQVDQG6SHFLILFDWLRQV8SRQFRPSOHWLRQRIFRQVWUXFWLRQLIWKHDFWXDO TXDQWLWLHVVKRZHLWKHUDQLQFUHDVHRUGHFUHDVHIURPWKHTXDQWLWLHVJLYHQLQWKH%LGVFKHGXOHWKH &RQWUDFW8QLW3ULFHVZLOOSUHYDLOVXEMHFWWRWKHSURYLVLRQVRI6HFWLRQ 7KHXQLWDQGOXPSVXPSULFHVWREHSDLGVKDOOEHIXOOFRPSHQVDWLRQIRUWKHLWHPVRIZRUNDQGDOO DSSXUWHQDQWZRUNLQFOXGLQJIXUQLVKLQJDOOPDWHULDOVODERUHTXLSPHQWWRROVDQGLQFLGHQWDOV 3D\PHQWZLOOQRWEHPDGHIRUPDWHULDOVZDVWHGRUGLVSRVHGRILQDPDQQHUQRWFDOOHGIRUXQGHU WKH&RQWUDFW7KLVLQFOXGHVUHMHFWHGPDWHULDOQRWXQORDGHGIURPYHKLFOHVPDWHULDOUHMHFWHGDIWHU Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 5HYLVHG&RQWUDFW1R$3DJHRI LWKDVEHHQSODFHGDQGPDWHULDOSODFHGRXWVLGHRIWKH3ODQOLQHV1RFRPSHQVDWLRQZLOOEH DOORZHGIRUGLVSRVLQJRIUHMHFWHGRUH[FHVVPDWHULDO 3D\PHQWIRUZRUNSHUIRUPHGRUPDWHULDOVIXUQLVKHGXQGHUDQ$VVHVVPHQW$FW&RQWUDFWZLOOEH PDGHDVSURYLGHGLQSDUWLFXODUSURFHHGLQJVRUOHJLVODWLYHDFWXQGHUZKLFKVXFKFRQWUDFWZDV DZDUGHG :KHQHYHUDQ\SRUWLRQRIWKH:RUNLVSHUIRUPHGE\WKH$JHQF\DWWKH&RQWUDFWRU¶VUHTXHVWWKH FRVWWKHUHRIVKDOOEHFKDUJHGDJDLQVWWKH&RQWUDFWRUDQGPD\EHGHGXFWHGIURPDQ\DPRXQW GXHRUEHFRPLQJGXHIURPWKH$JHQF\ :KHQHYHULPPHGLDWHDFWLRQLVUHTXLUHGWRSUHYHQWYLRODWLRQRIDQ\ODZLQMXU\GHDWKRUSURSHUW\ GDPDJHDQGSUHFDXWLRQVZKLFKDUHWKH&RQWUDFWRU¶VUHVSRQVLELOLW\KDYHQRWEHHQWDNHQDQGDUH QRWUHDVRQDEO\H[SHFWHGWREHWDNHQWKH$JHQF\PD\DIWHUUHDVRQDEOHDWWHPSWWRQRWLI\WKH &RQWUDFWRUFDXVHVXFKSUHFDXWLRQVWREHWDNHQDQGVKDOOFKDUJHWKHFRVWWKHUHRIDJDLQVWWKH &RQWUDFWRURUPD\GHGXFWVXFKFRVWIURPDQ\DPRXQWGXHRUEHFRPLQJGXHIURPWKH$JHQF\ $JHQF\DFWLRQRULQDFWLRQXQGHUVXFKFLUFXPVWDQFHVVKDOOQRWEHFRQVWUXHGDVUHOLHYLQJWKH &RQWUDFWRURULWV6XUHW\IURPOLDELOLW\ 3D\PHQWVKDOOQRWUHOLHYHWKH&RQWUDFWRUIURPLWVREOLJDWLRQVXQGHUWKH&RQWUDFW QRUVKDOOVXFK SD\PHQWEHFRQVWUXHGWREHDFFHSWDQFHRIDQ\RIWKH:RUN3D\PHQWVKDOOQRWEHFRQVWUXHGDV WKH WUDQVIHU RI RZQHUVKLS RI DQ\ HTXLSPHQW RU PDWHULDOV WR WKH$JHQF\ 5HVSRQVLELOLW\ RI RZQHUVKLSVKDOOUHPDLQZLWKWKH&RQWUDFWRUZKRVKDOOEHREOLJDWHGWRVWRUHDQ\IXOO\RUSDUWLDOO\ FRPSOHWHGZRUNRUVWUXFWXUHIRUZKLFKSD\PHQWKDVEHHQPDGH RUUHSODFHDQ\PDWHULDOVRU HTXLSPHQWUHTXLUHGWREHSURYLGHGXQGHUWKH&RQWUDFWZKLFKPD\EHGDPDJHGORVWVWROHQRU RWKHUZLVHGHJUDGHGLQDQ\ZD\SULRUWRDFFHSWDQFHRIWKH:RUNH[FHSWDVSURYLGHGLQ6HFWLRQ *XDUDQWHHSHULRGVVKDOOQRWEHDIIHFWHGE\DQ\SD\PHQWEXWVKDOOFRPPHQFHRQWKHGDWHRI UHFRUGDWLRQRIWKH³1RWLFHRI&RPSOHWLRQ´ ,IZLWKLQWKHWLPHIL[HGE\ODZDSURSHUO\H[HFXWHGQRWLFHWRVWRSSD\PHQWLVILOHGZLWKWKH $JHQF\GXHWRWKH&RQWUDFWRU¶VIDLOXUHWRSD\IRUODERURUPDWHULDOVXVHGLQWKH:RUNDOOPRQH\ GXHIRUVXFKODERURUPDWHULDOVZLOOEHZLWKKHOGIURPSD\PHQWWRWKH&RQWUDFWRULQDFFRUGDQFH ZLWKDSSOLFDEOHODZV $WWKH H[SLUDWLRQ RI GD\VIURPWKH GDWH RIDFFHSWDQFH RI WKH:RUN E\WKH %RDUG RU DV SUHVFULEHGE\ODZWKHDPRXQWGHGXFWHGIURPWKHILQDOHVWLPDWHDQGUHWDLQHGE\WKH$JHQF\ZLOO EHSDLGWRWKH&RQWUDFWRUH[FHSWVXFKDPRXQWVDVDUHUHTXLUHGE\ODZWREHZLWKKHOGE\SURSHUO\ H[HFXWHGDQGILOHGQRWLFHVWRVWRSSD\PHQWRUDVPD\EHDXWKRUL]HGE\WKH&RQWUDFWWREH IXUWKHUUHWDLQHG 3DUWLDO DQG )LQDO 3D\PHQW 7KH (QJLQHHU ZLOO DIWHU DZDUG RI &RQWUDFW HVWDEOLVK D FORVXUH GDWH IRU WKH SXUSRVH RI PDNLQJ PRQWKO\ SURJUHVV SD\PHQWV 7KH &RQWUDFWRU PD\ UHTXHVWLQZULWLQJWKDWVXFKPRQWKO\FORVXUHGDWHEHFKDQJHG7KH(QJLQHHUPD\DSSURYHVXFK UHTXHVWZKHQLWLVFRPSDWLEOHZLWKWKH$JHQF\¶VSD\PHQWSURFHGXUH (DFKPRQWKWKH(QJLQHHUZLOOPDNHDQDSSUR[LPDWHPHDVXUHPHQWRIWKHZRUNSHUIRUPHGWRWKH FORVXUHGDWHDVEDVLVIRUPDNLQJPRQWKO\SURJUHVVSD\PHQWV7KHHVWLPDWHGYDOXHZLOOEHEDVHG RQFRQWUDFWXQLWSULFHVFRPSOHWHGFKDQJHRUGHUZRUNDQGDVSURYLGHGIRULQ6HFWLRQ RI WKHVH*HQHUDO3URYLVLRQV3URJUHVVSD\PHQWVVKDOOEHPDGHQRODWHUWKDQWKLUW\ FDOHQGDU Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 5HYLVHG&RQWUDFW1R$3DJHRI GD\VDIWHUWKHFORVXUHGDWH)LYH ZRUNLQJGD\VIROORZLQJWKHFORVXUHGDWHWKH(QJLQHHUVKDOO FRPSOHWHWKHGHWDLOHGSURJUHVVSD\HVWLPDWHDQGVXEPLWLWWRWKH&RQWUDFWRUIRUWKH&RQWUDFWRU¶V LQIRUPDWLRQ6KRXOGWKH&RQWUDFWRUDVVHUWWKDWDGGLWLRQDOSD\PHQWLVGXHWKH&RQWUDFWRUVKDOO ZLWKLQWHQ GD\VRIUHFHLSWRIWKHSURJUHVVHVWLPDWHVXEPLWDVXSSOHPHQWDOSD\PHQWUHTXHVW WR WKH (QJLQHHU ZLWK DGHTXDWH MXVWLILFDWLRQ VXSSRUWLQJ WKH DPRXQW RI VXSSOHPHQWDO SD\PHQW UHTXHVW8SRQUHFHLSWRIWKHVXSSOHPHQWDOSD\PHQWUHTXHVWWKH(QJLQHHUVKDOODVVRRQDV SUDFWLFDEOH DIWHU UHFHLSW GHWHUPLQH ZKHWKHU WKH VXSSOHPHQWDO SD\PHQW UHTXHVW LV D SURSHU SD\PHQW UHTXHVW ,I WKH (QJLQHHU GHWHUPLQHV WKDW WKH VXSSOHPHQWDO SD\PHQW UHTXHVW LV QRW SURSHUWKHQWKHUHTXHVWVKDOOEHUHWXUQHGWRWKH&RQWUDFWRUDVVRRQDVSUDFWLFDEOHEXWQRWODWHU WKDQVHYHQ GD\VDIWHUUHFHLSW7KHUHWXUQHGUHTXHVWVKDOOEHDFFRPSDQLHGE\DGRFXPHQW VHWWLQJIRUWKLQZULWLQJWKHUHDVRQVZK\WKHVXSSOHPHQWDOSD\PHQWUHTXHVWZDVQRWSURSHU,Q FRQIRUPDQFHZLWK3XEOLF&RQWUDFW&RGH6HFWLRQWKH&LW\VKDOOPDNHSD\PHQWVZLWKLQ WKLUW\ GD\VDIWHUUHFHLSWRIDQXQGLVSXWHGDQGSURSHUO\VXEPLWWHGVXSSOHPHQWDOSD\PHQW UHTXHVWIURPWKH&RQWUDFWRU,ISD\PHQWRIWKHXQGLVSXWHGVXSSOHPHQWDOSD\PHQWUHTXHVWLVQRW PDGHZLWKLQWKLUW\ GD\VDIWHUUHFHLSWE\WKH(QJLQHHUWKHQWKH&LW\VKDOOSD\LQWHUHVWWRWKH &RQWUDFWRUHTXLYDOHQWWRWKHOHJDOUDWHVHWIRUWKLQVXEGLYLVLRQ D RI6HFWLRQRIWKH&RGH RI&LYLO3URFHGXUH )URPHDFKSURJUHVVHVWLPDWHSHUFHQWZLOOEHGHGXFWHGDQGUHWDLQHGE\WKH$JHQF\DQGWKH UHPDLQGHUOHVVWKHDPRXQWRIDOOSUHYLRXVSD\PHQWVZLOOEHSDLG7KH$JHQF\ZLOOZLWKKROGQRW OHVVWKDQSHUFHQWRIWKHWRWDO&RQWUDFWDPRXQWXQWLODFFHSWDQFHRIWKHSHUIRUPDQFHRIWKH &RQWUDFW 1R SURJUHVV SD\PHQW PDGH WR WKH &RQWUDFWRU RU LWV VXUHWLHV ZLOO FRQVWLWXWH D ZDLYHU RI WKH OLTXLGDWHGGDPDJHVXQGHU $V SURYLGHG LQ 6HFWLRQ RI WKH &DOLIRUQLD 3XEOLF &RQWUDFW&RGH WKH &RQWUDFWRU PD\ VXEVWLWXWHVHFXULWLHVIRUDQ\PRQLHVZLWKKHOGE\WKH$JHQF\WRHQVXUHSHUIRUPDQFHXQGHUWKH &RQWUDFW $IWHU ILQDO LQVSHFWLRQ WKH (QJLQHHU ZLOO PDNH D )LQDO 3D\PHQW(VWLPDWH DQG SURFHVV D FRUUHVSRQGLQJSD\PHQW7KLVHVWLPDWHZLOOEHLQZULWLQJDQGVKDOOEHIRUWKHWRWDODPRXQWRZHG WKH&RQWUDFWRUDVGHWHUPLQHGE\WKH(QJLQHHUDQGVKDOOEHLWHPL]HGE\WKHFRQWUDFWELGLWHPDQG FKDQJHRUGHULWHPZLWKTXDQWLWLHVDQGSD\PHQWDPRXQWVDQGVKDOOVKRZDOOGHGXFWLRQVPDGHRU WREHPDGHIRUSULRUSD\PHQWVDQGDPRXQWVWREHGHGXFWHGXQGHUSURYLVLRQVRIWKHFRQWUDFW $OOSULRUHVWLPDWHVDQGSURJUHVVSD\PHQWVVKDOOEHVXEMHFWWRFRUUHFWLRQLQWKH)LQDO3D\PHQW (VWLPDWH 7KH&RQWUDFWRUVKDOOKDYHFDOHQGDUGD\VIURPUHFHLSWRIWKH)LQDO3D\PHQW(VWLPDWHWRPDNH ZULWWHQVWDWHPHQWGLVSXWLQJDQ\ELGLWHPRUFKDQJHRUGHULWHPTXDQWLW\RUSD\PHQWDPRXQW7KH &RQWUDFWRUVKDOOSURYLGHDOOGRFXPHQWDWLRQDWWKHWLPHRIVXEPLWWLQJWKHVWDWHPHQWVXSSRUWLQJLWV SRVLWLRQ6KRXOGWKH&RQWUDFWRUIDLOWRVXEPLWWKHVWDWHPHQWDQGVXSSRUWLQJGRFXPHQWDWLRQZLWKLQ WKHWLPHVSHFLILHGWKH&RQWUDFWRUDFNQRZOHGJHVWKDWIXOODQGILQDOSD\PHQWKDVEHHQPDGHIRU DOOFRQWUDFWELGLWHPVDQGFKDQJHRUGHULWHPV ,IWKH&RQWUDFWRUVXEPLWVDZULWWHQVWDWHPHQWZLWKGRFXPHQWDWLRQLQWKHDIRUHPHQWLRQHGWLPH WKH(QJLQHHUZLOOUHYLHZWKHGLVSXWHGLWHPZLWKLQFDOHQGDUGD\VDQGPDNHDQ\DSSURSULDWH DGMXVWPHQWVRQWKH)LQDO3D\PHQW5HPDLQLQJGLVSXWHGTXDQWLWLHVRUDPRXQWVQRWDSSURYHGE\ WKH(QJLQHHUZLOOEHVXEMHFWWRUHVROXWLRQDVVSHFLILHGLQ6HFWLRQ'LVSXWHG:RUN Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 5HYLVHG&RQWUDFW1R$3DJHRI 7KHZULWWHQVWDWHPHQWILOHGE\WKH&RQWUDFWRUVKDOOEHLQVXIILFLHQWGHWDLOWRHQDEOHWKH(QJLQHHU WRDVFHUWDLQWKHEDVLVDQGDPRXQWRIVDLGGLVSXWHGLWHPV7KH(QJLQHHUZLOOFRQVLGHUWKHPHULWV RI WKH &RQWUDFWRU¶V FODLPV ,W ZLOO EH WKH UHVSRQVLELOLW\ RI WKH &RQWUDFWRU WR IXUQLVK ZLWKLQ D UHDVRQDEOHWLPHVXFKIXUWKHULQIRUPDWLRQDQGGHWDLOVDVPD\EHUHTXLUHGE\WKH(QJLQHHUWR GHWHUPLQHWKHIDFWVRUFRQWHQWLRQVLQYROYHGLQLWVFODLPV)DLOXUHWRVXEPLWVXFKLQIRUPDWLRQDQG GHWDLOVZLOOEHVXIILFLHQWFDXVHIRUGHQ\LQJSD\PHQWIRUWKHGLVSXWHGLWHPV 3D\PHQW IRU &ODLPV([FHSWIRUWKRVHILQDOSD\PHQWLWHPVGLVSXWHGLQWKHZULWWHQ VWDWHPHQWUHTXLUHGLQ6HFWLRQ DOOFODLPVRI DQ\GROODU DPRXQW VKDOO EH VXEPLWWHG LQD ZULWWHQ VWDWHPHQW E\ WKH &RQWUDFWRU QR ODWHU WKDQ WKH GDWH RI UHFHLSW RI WKH ILQDO SD\PHQW HVWLPDWH7KRVHILQDOSD\PHQWLWHPVGLVSXWHGLQWKHZULWWHQVWDWHPHQWUHTXLUHGLQ6HFWLRQ VKDOOEHVXEPLWWHGQRODWHUWKDQGD\VDIWHUUHFHLSWRIWKH)LQDO3D\PHQWHVWLPDWH1RFODLP ZLOOEHFRQVLGHUHGWKDWZDVQRWLQFOXGHGLQWKLVZULWWHQVWDWHPHQWQRUZLOODQ\FODLPEHDOORZHG IRU ZKLFK ZULWWHQ QRWLFH RU SURWHVW LV UHTXLUHGXQGHU DQ\ SURYLVLRQ RIWKLV FRQWUDFW LQFOXGLQJ 6HFWLRQV&KDQJHG&RQGLWLRQV'LVSXWHG:RUN3D\PHQWIRU'HOD\VWR&RQWUDFWRU :ULWWHQ1RWLFHDQG5HSRUWRU&RQWUDFW7LPH$FFRXQWLQJXQOHVVWKH&RQWUDFWRUKDV FRPSOLHGZLWKQRWLFHRUSURWHVWUHTXLUHPHQWV 7KHFODLPVILOHGE\WKH&RQWUDFWRUVKDOOEHLQVXIILFLHQWGHWDLOWRHQDEOHWKH(QJLQHHUWRDVFHUWDLQ WKHEDVLVDQGDPRXQWRIVDLGFODLPV7KH(QJLQHHUZLOOFRQVLGHUDQGGHWHUPLQHWKH&RQWUDFWRU¶V FODLPVDQGLWZLOOEHWKHUHVSRQVLELOLW\RIWKH&RQWUDFWRUWRIXUQLVKZLWKLQDUHDVRQDEOHWLPHVXFK IXUWKHULQIRUPDWLRQDQGGHWDLOVDVPD\EHUHTXLUHGE\WKH(QJLQHHUWRGHWHUPLQHWKHIDFWVRU FRQWHQWLRQVLQYROYHGLQLWVFODLPV)DLOXUHWRVXEPLWVXFKLQIRUPDWLRQDQGGHWDLOVZLOOEHVXIILFLHQW FDXVHIRUGHQ\LQJWKHFODLPV 3D\PHQWIRUFODLPVVKDOOEHSURFHVVHGZLWKLQFDOHQGDUGD\VRIWKHLUUHVROXWLRQIRUWKRVH FODLPVDSSURYHGE\WKH(QJLQHHU7KH&RQWUDFWRUVKDOOSURFHHGZLWKLQIRUPDOGLVSXWHUHVROXWLRQ XQGHU6HFWLRQ'LVSXWHG:RUNIRUWKRVHFODLPVUHPDLQLQJLQGLVSXWH 'HOLYHUHG 0DWHULDOV 7KH FRVW RI PDWHULDOV DQG HTXLSPHQW GHOLYHUHG EXW QRW LQFRUSRUDWHGLQWRWKHZRUNZLOOQRWEHLQFOXGHGLQWKHSURJUHVVHVWLPDWH 0RELOL]DWLRQ :KHQ DELG LWHP LV LQFOXGHG LQ WKH 3URSRVDO IRUP IRU0RELOL]DWLRQDQG VXEMHFWWRWKHFRQGLWLRQVDQGOLPLWDWLRQVLQWKH6SHFLILFDWLRQVWKHFRVWVRIZRUNLQDGYDQFHRI FRQVWUXFWLRQRSHUDWLRQVDQGQRWGLUHFWO\DWWULEXWDEOHWRDQ\VSHFLILFELGLWHPZLOOEHLQFOXGHGLQ WKHSURJUHVVHVWLPDWH:KHQQRVXFKELGLWHPLVSURYLGHGSD\PHQW IRU VXFK FRVWV ZLOO EH FRQVLGHUHGWREHLQFOXGHGLQWKHRWKHULWHPVRIZRUN 0RELOL]DWLRQDQG3UHSDUDWRU\:RUN3D\PHQWIRU0RELOL]DWLRQDQG3UHSDUDWRU\:RUN ZLOOEHPDGHDWWKH&RQWUDFWSULFHDQGLQFOXGHVIXOOFRPSHQVDWLRQIRUIXUQLVKLQJDOOLQVXUDQFH ERQGVOLFHQVHVODERUPDWHULDOVXWLOLWLHVWRROVHTXLSPHQWDQGLQFLGHQWDOVDQGIRUGRLQJDOOWKH ZRUNLQYROYHGLQPRELOL]DWLRQDQGSUHSDUDWRU\ZRUNDQGRSHUDWLRQVLQFOXGLQJEXWQRWOLPLWHGWR WKRVH QHFHVVDU\ IRU WKH PRYHPHQW RI SHUVRQQHO HTXLSPHQW VXSSOLHV DQG LQFLGHQWDO WR SUHSDULQJWRFRQGXFWZRUNRQDQGRIIWKHSURMHFWVLWHDQGRWKHURIIVLWHIDFLOLWLHVQHFHVVDU\IRU ZRUN RQ WKH SURMHFW IRU DOO RWKHU IDFLOLWLHV VXUHWLHV ZRUN DQG RSHUDWLRQV ZKLFK PXVW EH SHUIRUPHGRUFRVWVLQFXUUHGSULRUWREHJLQQLQJZRUN RQYDULRXVFRQWUDFWLWHPVRQRURIIWKH SURMHFWVLWHH[FHSWLQJWKRVHVSHFLILFDOO\SDLGIRUXQGHUVHSDUDWHELGLWHPV6XFKDFWLYLWLHVVKDOO LQFOXGH EXW DUH QRW OLPLWHG WR FRRUGLQDWLRQ ZLWK $JHQF\ IRUFHV VHFXULQJ SHUPLWV SUHFRQVWUXFWLRQVXUYH\ YLGHRDQGSKRWRJUDSKV VXUYH\LQJDQGVWDNLQJVHFXULQJFRQVWUXFWLRQ ZDWHUVXSSO\SURYLGLQJSRZHUQHFHVVDU\IRUFRQVWUXFWLRQSURYLGLQJDOOWHPSRUDU\FRQVWUXFWLRQ IHQFLQJ LQVWDOOLQJ PDLQWDLQLQJ DQG UHPRYLQJ SURMHFW VLJQV 3UHSDULQJ LPSOHPHQWLQJ DQG Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 5HYLVHG&RQWUDFW1R$3DJHRI PDLQWDLQLQJD6WRUP:DWHU3ROOXWLRQ3ODQ 6:333 DQGDVVRFLDWHG%03V SURYLGLQJRQVLWH VDQLWDU\IDFLOLWLHV SRVWLQJ26+$UHTXLUHPHQWVDQGHVWDEOLVKLQJVDIHW\SURJUDPVGHPRELOL]DWLRQ DQGDQ\RWKHUZRUNRUVHUYLFHVQRWLQFOXGHGLQDQ\RWKHUELGLWHP0RELOL]DWLRQDOVRLQFOXGHVWKH FRVWWRIXOILOODOOUHVSRQVLELOLWLHVRIWKH&RQWUDFWRUGHILQHGLQ6HFWLRQDQGIRUPDLQWDLQLQJDQG VXEPLWWLQJWKHSURMHFWUHFRUGGUDZLQJVDWWKHHQGRIWKHSURMHFW7KHVHUHFRUGGUDZLQJVPXVWEH UHYLHZHGPRQWKO\ZLWKWKH$JHQF\WRUHFHLYHSURJUHVVRUILQDOSD\PHQWVIRUDQ\ZRUN 7KH &RQWUDFWRUKHUHE\DJUHHVWKDWWKHSULFHSDLGLVVXIILFLHQWIRU0RELOL]DWLRQDQG3UHSDUDWRU\:RUN DV GHVFULEHG LQ WKLV VHFWLRQ DQG WKDW WKH &RQWUDFWRU VKDOO KDYH QR ULJKW WR DGGLWLRQDO FRPSHQVDWLRQIRU0RELOL]DWLRQDQG3UHSDUDWRU\:RUN 3URJUHVVSD\PHQWVIRU0RELOL]DWLRQDQG3UHSDUDWRU\:RUNZLOOEHPDGHDVIROORZV )RUWKHILUVWSURJUHVVSD\PHQW DIWHUWKHLVVXDQFHRIWKH1RWLFHWR3URFHHG SD\PHQWZLOOEH PDGHDWIRUW\SHUFHQW RIWKHDPRXQWELGIRU0RELOL]DWLRQDQG3UHSDUDWRU\:RUN)RUWKH VHFRQGSURJUHVVSD\PHQWSD\PHQWZLOOEHPDGHDWILIW\SHUFHQW RIWKHDPRXQWELGIRU 0RELOL]DWLRQDQG3UHSDUDWRU\:RUN7KHUHPDLQLQJRIWKHDPRXQWELGIRU0RELOL]DWLRQDQG 3UHSDUDWRU\:RUNZLOOEHPDGHZKHQDOOSXQFKOLVWLWHPVDUHVLJQHGRIIDQGFRPSOHWHGWRWKH VDWLVIDFWLRQ RI WKH &LW\ ,QVSHFWRU DQG WKH &RQWUDFWRU KDV FRPSOHWHO\ GHPRELOL]HG IURP WKH SURMHFWVLWH V %,',7(063D\PHQWIRUHDFK%LG,WHPVKDOOEHPDGHDWWKHTXDQWLW\DQGW\SHDVOLVWHG LQ WKH &RQWUDFWRU V 3URSRVDO $OO ZRUN VKRZQ RU PHQWLRQHG RQ WKH SODQV LQ WKH &RQWUDFW 'RFXPHQWV*HQHUDO3URYLVLRQVRU7HFKQLFDO3URYLVLRQV6SHFLILFDWLRQVVKDOOEHFRQVLGHUHGDV LQFOXGHGLQWKH%LG,WHPV&RQWUDFWRUPXVWSURWHFWH[LVWLQJXWLOLWLHVLPSURYHPHQWVODQGVFDSLQJ LUULJDWLRQ V\VWHPV DQG YHJHWDWLRQ LQ SODFH ,I GDPDJHG GXULQJWKH ZRUN &RQWUDFWRU LV UHVSRQVLEOHWRUHSDLURUUHSODFHDQ\XWLOLWLHVLPSURYHPHQWVODQGVFDSLQJLUULJDWLRQV\VWHPVDQG YHJHWDWLRQDWKLVH[SHQVH 7KH&RQWUDFWRU¶VELGSULFHIRUHDFKELGLWHPVKDOOLQFOXGHDOOSHUPDQHQWDQGWHPSRUDU\HQWU\ V\VWHPVVWUXFWXUDOVXSSRUWV\VWHPVVDIHW\V\VWHPVWHVWLQJDLUDQGVWRUPZDWHUPDQDJHPHQW %03V REWDLQLQJ SHUPLWV DQG HIIHFWLYH FRRUGLQDWLRQ ZLWK LQVSHFWLRQ DQG FRQVWUXFWLRQ PDQDJHPHQW WHDPV WR GHOLYHU D FRPSOHWHG ILWWHG DQG IXOO\ IXQFWLRQDO ILQLVKHG SURGXFW , DFFRUGDQFHZLWKWKHVSHFLILFDWLRQVDQGLQGXVWU\VWDQGDUGVRISUDFWLFH 0RELOL]DWLRQ 7KH FRQWUDFW OXPS VXP SDLG IRU WKLV ELG LWHP VKDOO FRQVWLWXWH IXOO FRPSHQVDWLRQ WR SURYLGH PRELOL]DWLRQSUHSDUDWRU\ZRUNDQGGHPRELOL]DWLRQZRUNLQDFFRUGDQFHZLWK6HFWLRQ 7KH &RQWUDFWRU¶VELGSULFHIRU0RELOL]DWLRQVKDOOQRWH[FHHGRIWKHEDVHELGIRUWKHUHVSHFWLYH %LG6FKHGXOHUHTXLULQJWKHPRELOL]DWLRQ 5HPRYHVWHHODQFKRUSRLQWDQGUHSODFHZLWKZHOGHGVWHHO'5LQJWLHRIIEUDFNHW 7KHFRQWUDFWXQLWSULFHSDLGIRUWKLVELGLWHPVKDOOFRQVWLWXWHIXOOFRPSHQVDWLRQWRUHPRYHDQG GLVSRVHH[LVWLQJZHOGHGVWHHODQFKRUSRLQWVRQWKHURRIRIWKHIDFLOLW\ JULQGLQJDUHDWRDIOXVK VPRRWKILQLVK DQGIXUQLVKLQJDQGLQVWDOOLQJDQHZKHDY\GXW\ZHOGRQVWHHO'5LQJDQFKRUSRLQW IRUWRROHTXLSPHQWDQGSHUVRQQHOWLHRII$QFKRUSRLQWVVKDOOKDYHDPLQLPXPLQFK[LQFK ZHOGHG¶¶VWHHOJXVVHWSODWHZLWKPLQLPXPLQFKULQJGLDPHWHUKDUGHQHGDQGFRDWHGVWHHO KDUGZDUH Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 5HYLVHG&RQWUDFW1R$3DJHRI 5HPRYHDQGGLVSRVHLQWHULRUVWHHOODGGHUDQGVXSSRUWEHDPV 7KHFRQWUDFWOXPSVXPSDLGIRUWKLVELGLWHPVKDOOFRQVWLWXWHIXOOFRPSHQVDWLRQWRUHPRYHDQG GLVSRVHWKHH[LVWLQJLQWHULRUVWHHOODGGHUZLWKLQHDFKWDQNDQGWKHDVVRFLDWHGVXSSRUWEHDPV 7KHH[LVWLQJZHOGVVXSSRUWLQJWKHODGGHUVKDOOEHJURXQGWRDVPRRWKILQLVK ZLWKWKHWDQN¶V LQWHULRUZDOO )XUQLVKDQGLQVWDOOJXDUGUDLOH[WHQVLRQ 7KHFRQWUDFWOXPSVXPFRVWSDLGIRUWKLVELGLWHPVKDOOFRQVWLWXWHIXOOFRPSHQVDWLRQWRIXUQLVK DQGLQVWDOOURRIJXDUGUDLOLQJWRH[WHQGWKHUDLOLQJH[WHQWVIHHWDWERWK(OPDQG6N\OLQH7DQNV WRDFKLHYHFRPSOLDQFHZLWK$::$'7KHUDLOLQJVKDOOEHW\SLFDOWRWKHGHWDLOSURYLGHGLQ $SSHQGL['DQGPDWFKWKHH[LVWLQJUDLOLQJW\SHDQGFRORUDWHDFKWDQN3URSRVHG5DLOLQJVKDOO EH LQVWDOOHG ZKHUH QRWHG RQ WKH WDQN SKRWRV LQ $SSHQGL[ % DQG FRQQHFWHG WR WKH H[LVWLQJ DGMDFHQWUDLODQGILHOGZHOGHGWRWKHWDQNURRI 5HPRYHH[LVWLQJLQFKGLDPHWHURXWOHWSRUWDQGUHSODFHZLWKQHZLQFKGLDPHWHU IXOOFRXSOLQJW\SH66 7KH FRQWUDFW XQLW SULFH IRU WKLV LWHP VKDOO FRQVWLWXWH IXOO FRPSHQVDWLRQ WR IXUQLVK DOO ODERU HTXLSPHQWDQGPDWHULDOVWRUHPRYHDQGGLVSRVHLQFKGLDPHWHURXWOHWVKHOOSHQHWUDWLRQSLSLQJ IXUQLVKDQGLQVWDOOQHZLQFKGLDPHWHUIXOOFRXSOLQJ7\SH6WDLQOHVVVWHHO WHUPLQDWH FRXSOLQJZLWKGLHOHFWULFEXVKLQJSHUWKHGHWDLOSURYLGHGLQ$SSHQGL[' DQGWHPSRUDULO\UHPRYH DQGUHFRQQHFWH[LVWLQJEDOOYDOYHDQGDVVRFLDWHGVDPSOHSRUW )XUQLVKDQGLQVWDOOLQFKGLDPHWHUGHJUHHDQJOHEHQGILWWLQJRQWDQNLQWHULRULQOHW 7KHFRQWUDFWOXPSVXPSDLGIRUWKLVELGLWHPVKDOOFRQVWLWXWHIXOOFRPSHQVDWLRQWRIXUQLVKDQG LQVWDOOD,QFKGLDPHWHUGHJUHHDQJOHEHQGILWWLQJRQWKHLQOHWSLSLQJRIWKHWDQNLQWHULRU 7KHVWHHODQJOHEHQGVKDOOEHóLQFKWKLFNDQGILHOGZHOGHGWRWKHLQOHWSLSLQJSHUWKHGHWDLO SURYLGHGLQ$SSHQGL['2ULHQWDWLRQRIEHQGSODFHPHQWVKDOOEHGHWHUPLQHGE\WKHHQJLQHHUDW WKHWLPHRILQVWDOODWLRQ ([WHULRUOHDGEDVHGSDLQWLGHQWLILFDWLRQKDQGOLQJDQGGLVSRVDO 7KHFRQWUDFWOXPSVXPSDLGIRUWKLVELGLWHPVKDOOFRQVWLWXWHIXOOFRPSHQVDWLRQWRSURYLGHDOO ODERU PDWHULDO WRROV DQG HTXLSPHQW QHFHVVDU\ WR SURYLGH OHDGEDVHG SDLQW VDPSOLQJ LGHQWLILFDWLRQ SHUPLWWLQJ KDQGOLQJ DQG DEDWHPHQW IRU WKH WDQN¶V H[WHULRU FRDWLQJ V\VWHP LQ DFFRUGDQFHZLWK7HFKQLFDO6SHFLILFDWLRQ6HFWLRQV DQG7KHH[WHULRUEDVHFRDW RIHDFKWDQNKDVWHVWHGSRVLWLYHIRUKD]DUGRXVOHYHOVRIOHDGDQGFKURPLXPDVGHWDLOHGLQWKH FRQWUDFWDSSHQGL[DQGWHFKQLFDOVSHFLILFDWLRQV 5HPRYHH[LVWLQJH[WHULRUFRDWLQJSHU663&63QHDUZKLWHEODVWFOHDQLQJ 7KHFRQWUDFWOXPSVXPSDLGIRUWKLVELGLWHPVKDOOFRQVWLWXWHIXOOFRPSHQVDWLRQWRSURYLGHDOO ODERUPDWHULDOWRROVDQGHTXLSPHQWWRUHPRYHDQGGLVSRVHRIWKHH[LVWLQJFRDWLQJV\VWHPRIWKH WDQN¶VH[WHULRUZLWKQHDUZKLWHEODVWFOHDQLQJSHUWKH6RFLHW\IRU3URWHFWLYH&RDWLQJV 663&63 1$&(1R7KHSULFHSDLGVKDOOLQFOXGHEXWQRWEHOLPLWHGWRSUHSDUDWLRQRIFRQWDLQPHQW DQGYHQWLODWLRQSODQVE\D&DOLIRUQLDFHUWLILHGLQGXVWULDOK\JLHQLVW SUHSDUDWLRQRIDKHDOWKDQG VDIHW\SODQ DSSOLFDEOHORFDORU6WDWHDLUSROOXWLRQFRQWUROSHUPLWVDQGSD\PHQWRIIHHV DLUTXDOLW\ PRQLWRULQJ DQG WHVWLQJ IRU FRPSOLDQFH ZLWK SHUPLWV GHVLJQ IDEULFDWLRQ DQG LQVWDOODWLRQ RI D FRQWDLQPHQWV\VWHPIRUDEUDVLYHEODVWLQJDQGFRDWLQJRSHUDWLRQV GHVLJQDQGLPSOHPHQWDWLRQRI DGHKXPLGLILFDWLRQDQGYHQWLODWLRQSODQ UHPRYLQJSURWHFWLQJDQGUHLQVWDOOLQJDSSXUWHQDQFHVQRW VFKHGXOHGIRUFRDWLQJVXFKDVHOHFWULFDOFRQGXLWZDWHUOHYHOLQGLFDWRUV\VWHPDQGVLJQDJH DEUDVLYH EODVWLQJ WKH WDQN¶V H[WHULRU VXUIDFHV LQFOXGLQJ URRI ZDOOV DQG DOO DVVRFLDWHG DSSXUWHQDQFHVSUHYLRXVO\FRDWHGLQFOXGLQJEXWQRWOLPLWHGWRURRIKDWFKHVYHQWFRYHUVODGGHU DQGIDOOSURWHFWLRQFDJHKDQGUDLOLQJPDQZD\VDQGRXWOHWSLSLQJ KDQGOLQJDQGGLVSRVDORI Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 5HYLVHG&RQWUDFW1R$3DJHRI VSHQWDEUDVLYHZDVKGRZQDQGKD]DUGRXVPDWHULDOV DQGDOOVHUYLFHVQHFHVVDU\WRUHPRYHWKH H[WHULRULQWHULRUFRDWLQJV\VWHPLQIXOO 5HPRYHH[LVWLQJLQWHULRUFRDWLQJSHU663&63QHDUZKLWHEODVWFOHDQLQJ 7KHFRQWUDFWOXPSVXPSDLGIRUWKLVELGLWHPVKDOOFRQVWLWXWHIXOOFRPSHQVDWLRQWRSURYLGHDOO ODERUPDWHULDOWRROVDQGHTXLSPHQWWRUHPRYHDQGGLVSRVHRIWKHH[LVWLQJFRDWLQJV\VWHPRIWKH WDQN¶VLQWHULRUZLWKQHDUZKLWHEODVWFOHDQLQJSHUWKH6RFLHW\IRU3URWHFWLYH&RDWLQJV 663& 63 1$&(1R7KHSULFHSDLGVKDOOLQFOXGHEXWQRWEHOLPLWHGWRSUHSDUDWLRQRIFRQWDLQPHQW DQGYHQWLODWLRQSODQVE\D&DOLIRUQLDFHUWLILHGLQGXVWULDOK\JLHQLVW SUHSDUDWLRQRIDKHDOWKDQG VDIHW\SODQ DSSOLFDEOHORFDORU6WDWHDLUSROOXWLRQFRQWUROSHUPLWVDQGSD\PHQWRIIHHV DLUTXDOLW\ PRQLWRULQJ DQG WHVWLQJ IRU FRPSOLDQFH ZLWK SHUPLWV GHVLJQ IDEULFDWLRQ DQG LQVWDOODWLRQ RI D FRQWDLQPHQWV\VWHPIRUDEUDVLYHEODVWLQJDQGFRDWLQJRSHUDWLRQV GHVLJQDQGLPSOHPHQWDWLRQRI DGHKXPLGLILFDWLRQDQGYHQWLODWLRQSODQ DEUDVLYHEODVWLQJDOOLQWHULRUH[SRVHGVXUIDFHVZLWKLQWKH WDQN LQFOXGLQJ EXW QRW OLPLWHG WR WKH WDQN¶V URRI IORRU ZDOOV UDIWHUV LQFOXGLQJ YRLG VSDFH EHWZHHQUDIWHUDQGURRI JLUGHUVUDIWHUVEHDPVFROXPQVDFFHVVPDQZD\VDQGLQWHULRUSLSLQJ KDQGOLQJDQGGLVSRVDORIVSHQWDEUDVLYHDQGZDVKGRZQPDWHULDOV DQGDOOVHUYLFHVQHFHVVDU\WR UHPRYHWKHH[LVWLQJLQWHULRUFRDWLQJV\VWHPLQIXOO )XUQLVKDQGLQVWDOOH[WHULRUFRDWLQJV\VWHP 7KHFRQWUDFWOXPSVXPSDLGIRUWKLVELGLWHPVKDOOFRQVWLWXWHIXOOFRPSHQVDWLRQWRSURYLGHDOO ODERUPDWHULDOWRROVDQGHTXLSPHQWIRUWKHVXUIDFHSUHSDUDWLRQDQGLQVWDOODWLRQRIDQRXWVLGH FRDWLQJ V\VWHP 2&6 RQ DOO H[WHULRU VXUIDFHV SUHYLRXVO\ EODVWFOHDQHG $OO ZRUN VKDOO EH FRPSOHWHGLQDFFRUGDQFHZLWK7HFKQLFDO6SHFLILFDWLRQ 7KHSULFHSDLGVKDOOLQFOXGHEXW QRW EH OLPLWHG WR SUHSDUDWLRQ RI FRQWDLQPHQW DQG YHQWLODWLRQ SODQV E\ D &DOLIRUQLD FHUWLILHG LQGXVWULDOK\JLHQLVW SUHSDUDWLRQRIDKHDOWKDQGVDIHW\SODQ DSSOLFDEOHORFDORU6WDWHDLUSROOXWLRQ FRQWURO SHUPLWV DQG SD\PHQW RI IHHV DLU TXDOLW\ PRQLWRULQJ DQG WHVWLQJ IRU FRPSOLDQFH ZLWK SHUPLWV GHVLJQIDEULFDWLRQDQGLQVWDOODWLRQRIDFRQWDLQPHQWV\VWHPIRUDEUDVLYHEODVWLQJDQG FRDWLQJRSHUDWLRQV GHVLJQDQGLPSOHPHQWDWLRQRIDGHKXPLGLILFDWLRQDQGYHQWLODWLRQSODQ ILHOG VXUIDFH SUHSDUDWLRQ RI ZHOGHG VWHHO WDQN DQG DSSXUWHQDQFHV DSSOLFDWLRQ FXULQJ DQG FRRUGLQDWLRQZLWK'LVWULFWIRUWHVWLQJDQGLQVSHFWLRQRILQWHULRUDQGH[WHULRUWDQNFRDWLQJV\VWHPV SRVWFRDWWDQNFOHDQLQJ DQGDOOLQFLGHQWDOZRUNRUVHUYLFHVUHTXLUHGWRFRDWWKHWDQNH[WHULRUDQG UHWXUQWKHIDFLOLW\EDFNWRVHUYLFH 5DIWHU*ULQGLQJ 7KHFRQWUDFWXQLWSULFHSDLGIRUWKLVELGLWHPVKDOOFRQVWLWXWHIXOOFRPSHQVDWLRQIRUIXUQLVKLQJDOO ODERUPDWHULDOVDQGHTXLSPHQWWRJULQGFRUURGHGDUHDVZLWKVKDUSRUGHODPLQDWHGHGJHVDV GHWHUPLQHGE\WKHHQJLQHHUWRDVPRRWKILQLVKDQGSUHSDUHGIRULQWHULRUFRDWLQJ3KRWRVRIWKH H[LVWLQJLQWHULRUFRQGLWLRQDUHSURYLGHGLQ$SSHQGL[%7KHFRQWUDFWXQLWSULFHVKDOOEHSDLGE\ FUHZKRXU7KHFRQWUDFWRU¶VELGUDWHVKDOOUHIOHFWWZRSHUVRQQHOSHUFUHZKRXU7LPHZLOOEH WUDFNHGDQGFRPSHQVDWHGE\WKHHQJLQHHUSHU6HFWLRQ )XUQLVKDQGLQVWDOOLQWHULRUFRDWLQJV\VWHP 7KHFRQWUDFWOXPSVXPSDLGIRUWKLVELGLWHPVKDOOFRQVWLWXWHIXOOFRPSHQVDWLRQWRSURYLGHDOO ODERUPDWHULDOWRROVDQGHTXLSPHQWIRUWKHLQVWDOODWLRQRIDQLQVLGHFRDWLQJV\VWHP ,&6 WRDOO LQWHULRU VXUIDFHV SUHYLRXVO\ EODVW FOHDQHG $OO ZRUN VKDOO EH FRPSOHWHG LQ DFFRUGDQFH ZLWK 7HFKQLFDO6SHFLILFDWLRQ 7KHSULFHSDLGVKDOOLQFOXGHEXWQRWEHOLPLWHGWRSUHSDUDWLRQRI FRQWDLQPHQWDQGYHQWLODWLRQSODQVE\D&DOLIRUQLDFHUWLILHGLQGXVWULDOK\JLHQLVW SUHSDUDWLRQRID KHDOWKDQGVDIHW\SODQ DSSOLFDEOHORFDORU6WDWHDLUSROOXWLRQFRQWUROSHUPLWVDQGSD\PHQWRI IHHV DLU TXDOLW\ PRQLWRULQJ DQG WHVWLQJ IRU FRPSOLDQFH ZLWK SHUPLWV GHVLJQ IDEULFDWLRQ DQG LQVWDOODWLRQRIDFRQWDLQPHQWV\VWHPIRUDEUDVLYHEODVWLQJDQGFRDWLQJRSHUDWLRQV GHVLJQDQG LPSOHPHQWDWLRQRIDGHKXPLGLILFDWLRQDQGYHQWLODWLRQSODQ ILHOGVXUIDFHSUHSDUDWLRQRIZHOGHG Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 5HYLVHG&RQWUDFW1R$3DJHRI VWHHOWDQNDQGDSSXUWHQDQFHV DSSOLFDWLRQFXULQJDQGFRRUGLQDWLRQZLWK'LVWULFWIRUWHVWLQJDQG LQVSHFWLRQ RI LQWHULRU DQG H[WHULRU WDQN FRDWLQJ V\VWHPV WDQNFOHDQLQJ GLVLQIHFWLRQ LQ DFFRUGDQFH0HWKRGRI$::$' EDFWHULDDQG92&WHVWLQJ DQGDOOLQFLGHQWDOZRUNRU VHUYLFHVUHTXLUHGWRFRDWWKHWDQNLQWHULRUDQGUHWXUQWKHIDFLOLW\EDFNWRVHUYLFH 5HSODFHURRIYHQWVFUHHQV 7KH FRQWUDFW OXPS VXP SDLG IRU WKLV ELG LWHP VKDOO FRQVWLWXWH IXOO FRPSHQVDWLRQ WR UHPRYH H[LVWLQJURRIYHQWVFUHHQVDQGIRUIXUQLVKLQJDQGLQVWDOOLQJQHZYHQWVFUHHQVLQNLQG6FUHHQLQJ VKDOOFRQVLVWRIDPHVKVWDLQOHVVVWHHOLQWHULRUVFUHHQDQGPHVKVWDLQOHVVVWHHOH[WHULRU VFUHHQ$OOFODPSVDQGLQWHULRUIUDPHVVKDOOEHUHSODFHGLQNLQG6FUHHQVL]HW\SHDQGTXDQWLW\ IRUHDFKWDQNDUHGHWDLOHGLQ$SSHQGL[$ 5HPRYHDQGUHSODFHH[WHULRUFKLPHODSFDXONLQJDQGEDFNHUURGLQNLQG 7KHFRQWUDFWOXPSVXPSDLGIRUWKLVELGLWHPVKDOOFRQVWLWXWHIXOOFRPSHQVDWLRQWRUHPRYHWKH H[LVWLQJFDXONLQJDQGEDFNHUURGEHWZHHQWKHH[WHULRUERWWRPSODWHH[WHQVLRQDQGWKHFRQFUHWH ZDOO ULQJ ZDOO LQWHUIDFH FKLPH URXWLQJ FOHDQLQJ DQG UHPRYLQJ GHEULV IURP WKH MRLQW DQG IXUQLVKLQJDQGLQVWDOOLQJQHZIOH[LEOHVHDODQWFDXONLQJDQGEDFNHUURGDURXQGWKHHQWLUHH[WHULRU SHULPHWHURIWKHWDQN Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 7(&+1,&$/63(&,),&$7,216 Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 6(&7,21 (;,67,1*&21',7,21,1)250$7,21 (/0$1'6.</,1(67((/ 5(6(592,5&2$7,1*352-(&7&2175$&7$ 3$57 *(1(5$/ '(6&5,37,21 $ *HQHUDO,QIRUPDWLRQRQWKHVWHHOWDQNUHVHUYRLUVVFKHGXOHGIRUZRUN džŝƐƚŝŶŐZĞƐĞƌǀŽŝƌƐ ĞƐĐƌŝƉƚŝŽŶ ůŵ^ŬLJůŝŶĞ zĞĂƌƵŝůƚϭϵϳϮϭϵϳϮ ^ŚĞůů,ĞŝŐŚƚ;ĨƚͿϮϮ͘ϱϮϮ͘ϱ ŝĂŵĞƚĞƌ;ĨƚͿϭϬϲϭϬϲ sŽůƵŵĞ;D'Ϳϭ͘ϱϭ͘ϱ džŝƐƚŝŶŐ/ŶƚĞƌŝŽƌŽĂƚŝŶŐ͕LJĞĂƌ ƉŽdžLJ/^ηϱ͕ϮϬϭϯ ƉŽdžLJ/^ηϱ͕ϮϬϭϯ džŝƐƚŝŶŐ/ŶƚĞƌŝŽƌ&d;ŵŝůͿϮϬϮϬ džŝƐƚŝŶŐ džƚĞƌŝŽƌŽĂƚŝŶŐ͕LJĞĂƌ ŬůLJĚKǀĞƌĐŽĂƚ͕ϭϵϵϲ ƉŽdžLJͬ,LJĚƌŽƉŚŽďŝĐĐƌLJůŝĐ KǀĞƌĐŽĂƚ͕ϮϬϭϯ ŬůLJĚKǀĞƌĐŽĂƚ͕ϭϵϵϱ ƉŽdžLJͬ,LJĚƌŽƉŚŽďŝĐĐƌLJůŝĐ KǀĞƌĐŽĂƚ͕ϮϬϭϯ džŝƐƚŝŶŐ džƚĞƌŝŽƌ&d;ŵŝůͿϮϬϮϬ džƚĞƌŝŽƌ>ĞĂĚĂƐĞŽĂƚ;WWDͿϭ͕ϴϵϬϲϲ džƚĞƌŝŽƌŚƌŽŵŝƵŵĂƐĞŽĂƚ ;WWDͿϯϱϭϳϴϯ džƚĞƌŝŽƌŽůŽƌdŶĞŵĞĐ,ϮϮƵĨĨĂůŽƌŽǁŶdŶĞŵĞĐ,ϮϮƵĨĨĂůŽƌŽǁŶ ^ŚĞůůDĂŶǁĂLJϯϬͲŝŶĐŚWƌŝŵĂƌLJ ϮϰͲŝŶĐŚ^ĞĐŽŶĚĂƌLJ ϯϬͲŝŶĐŚWƌŝŵĂƌLJ ϮϰͲŝŶĐŚ^ĞĐŽŶĚĂƌLJ ZŽŽĨĐĐĞƐƐ,ĂƚĐŚϯϲdžϯϲͲŝŶĐŚϯϲdžϯϲͲŝŶĐŚ ZŽŽĨĞŶƚĞƌsĞŶƚϯϲͲŝŶĐŚĂůƵŵŝŶƵŵĐŽŶĞŚĞĂĚϯϲͲŝŶĐŚĂůƵŵŝŶƵŵĐŽŶĞŚĞĂĚ ZŽŽĨ^ĞĐŽŶĚĂƌLJsĞŶƚͲͲ ZŽŽĨƵdžŝůŝĂƌLJsĞŶƚƐͲͲ % 5HVHUYRLU$FFHVVLELOLW\ D (OP7DQNLVORFDWHGDGMDFHQWWR'RQQD'ULYHLQWKHFLW\RI&DUOVEDG$FFHVV WRWKHIDFLOLW\LVSURYLGHGE\DSDYHGGULYHZD\IURP'RQQD'ULYH7KHVLWHLV HQFORVHGZLWKIHQFLQJDQGDVHFXULW\JDWH E 6N\OLQH7DQNLVORFDWHGDGMDFHQWWR6N\OLQH5RDGLQWKHFLW\RI&DUOVEDG $FFHVVWRWKHIDFLOLW\LVSURYLGHGE\DSDYHGGULYHZD\IURP6N\OLQH5RDG7KHVLWH LVHQFORVHGZLWKIHQFLQJDQGDVHFXULW\JDWH 3$57 0$7(5,$/6±12786(' Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 6(&7,21 (;,67,1*&21',7,21,1)250$7,21 (/0$1'6.</,1(67((/ 5(6(592,5&2$7,1*352-(&7&2175$&7$ 3$57 (;(&87,21 ϯ͘ϭ)$&,/,7<6+87'2:1 $ 7KHZRUNVKDOOEHFRPSOHWHGDWWKH(OPDQG6N\OLQHWDQNVLQFRQVHFXWLYHRUGHUZLWK RQO\RQHWDQNWDNHQRXWRIVHUYLFHDWDQ\JLYHQWLPH$OOZRUNVKDOOEHFRPSOHWHGDW (OPWDQNZLWKWKHUHVHUYRLUUHWXUQHGWRVHUYLFHSULRUWRSURJUHVVLQJWR6N\OLQHWDQN % 7KH &RQWUDFWRU VKDOO VXEPLW DQ ( IRUP DWWDFKHG LQ WKH FRQWUDFW WR IRUPDOO\ VFKHGXOHWKHVKXWGRZQRIWKHUHVHUYRLU7KHIRUPVKDOOEHVXEPLWWHGWRWKH'LVWULFW UHSUHVHQWDWLYHDPLQLPXPRIWZRZHHNVLQDGYDQFHRIWKHUHTXHVWHGVKXWGRZQGDWH 'LVWULFWSHUVRQQHOZLOOFRQGXFWWKHVKXWGRZQDQGGHZDWHUWKHIDFLOLW\ ϯ͘Ϯ86(2))$&,/,7< $ 7KH&RQWUDFWRUPD\PRELOL]HWRWKHVLWHXSRQIDFLOLW\VKXWGRZQ7KHIDFLOLW\¶VSUHPLVH PD\EHXVHGIRUVWDJLQJE\WKH&RQWUDFWRU$FFHVVWRWKHWDQNYDOYLQJVDPSOLQJ VWDWLRQVDQGRWKHUDSSXUWHQDQFHVPXVWEHSURYLGHGWR'LVWULFWVWDIIXSRQUHTXHVW % 7KH&RQWUDFWRULVUHVSRQVLEOHIRUDOOVLWHVHFXULW\XSRQPRELOL]DWLRQDQGVKDOOSURYLGH DJDWHORFNWRGDLV\FKDLQLQWRWKHH[LVWLQJORFNVHULHV & 7KH&RQWUDFWRUVKDOOSURYLGHDOOHOHFWULFDOSRZHUUHTXLUHGWRFRPSOHWHWKHZRUNZLWKRXW FRQQHFWLRQWR&DUOVEDGRQVLWHSRZHU*HQHUDWRUVVKDOOEHVRXQGDWWHQXDWHGWRG%D DWIHHW ' $'LVWULFWZDWHUVRXUFHFDQEHPDGHDYDLODEOHWKURXJKWKHQHDUHVWILUHK\GUDQWWRWKH VLWH,ID'LVWULFWZDWHUVRXUFHLVUHTXHVWHGWKH&RQWUDFWRUVKDOOREWDLQDFRQVWUXFWLRQ ZDWHUPHWHUSHUPLWWKURXJKWKHFLW\¶VHQJLQHHULQJIURQWFRXQWHURURQOLQHSHUPLWSRUWDO DQGSD\DOOSHUPLWDQGPHWHUHGIHHV ( 7HPSRUDU\ PRELOH VDQLWDWLRQ IDFLOLWLHV VKDOO EH IXUQLVKHG DQG PDLQWDLQHG E\ WKH &RQWUDFWRU 7KH&RQWUDFWRUVKDOONHHSWKHZRUNDUHDLQDFOHDQFRQGLWLRQDQGVKDOOQRWSHUPLW FRQVWUXFWLRQPDWHULDOVRUGHEULVWRDFFXPXODWHDVWRFRQVWLWXWHDQXLVDQFHRUKD]DUG WRWKHSURVHFXWLRQRIWKHZRUNRUWKHRSHUDWLRQRIWKHH[LVWLQJIDFLOLWLHV ϯ͘ϯ)$&,/,7<67$5783 $ 7KH&RQWUDFWRUVKDOOSURYLGHZULWWHQQRWLFHWRWKH'LVWULFWUHTXHVWLQJWKHIDFLOLW\WRUHWXUQ WRVHUYLFHXSRQFRPSOHWLRQRIDOOLPSURYHPHQWVVFKHGXOHGIRUWKHVLWHDQGVXFFHVVIXO ZDWHUTXDOLW\WHVWLQJDVVSHFLILHGHOVHZKHUHLQWKH7HFKQLFDO6SHFLILFDWLRQV % :LWKLQWZRZHHNVRIWKH&RQWUDFWRU¶VZULWWHQQRWLFH'LVWULFWSHUVRQQHOZLOOFRQGXFWD SUHOLPLQDU\VLWHZDONWRYHULI\WKHIDFLOLW\FDQVDIHO\EHUHWXUQHGWRVHUYLFHDQGWRHQVXUH DOOLPSURYHPHQWVDUHFRPSOHWH & 'LVWULFWSHUVRQQHOZLOOWKHQUHWXUQWKHIDFLOLW\WRVHUYLFH7KH&RQWUDFWRUVKDOOGHPRELOL]H IURPWKHIDFLOLW\DQGPRELOL]HWRWKHQH[WIDFLOLW\XSRQVXFFHVVIXOILOOLQJDQGRSHUDWLRQ RIWKHWDQN (1'2)6(&7,21 Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 6(&7,21 /($'%$6('3$,175(0(',$7,21 (/0$1'6.</,1(67((/ 5(6(592,5&2$7,1*352-(&7 &2175$&7$ 3$57 *(1(5$/ '(6&5,37,21 $ 7KHZRUNLQWKLV6HFWLRQLQFOXGHV,GHQWLILFDWLRQKDQGOLQJWHVWLQJDQGGLVSRVDORIOHDG EDVHGSDLQWLQWKHH[WHULRUFRDWLQJRIWKHVWHHOUHVHUYRLUV 5()(5(1&(63(&,),&$7,216$1'67$1'$5'6 $ $670'7HUPLQRORJ\5HODWLQJWR3DLQW9DUQLVK/DFTXHUDQG5HODWHG3URGXFWV % (QYLURQPHQWDO3URWHFWLRQ$JHQF\ (3$ 5HJXODWLRQ&)5 & 2FFXSDWLRQDO 6DIHW\ DQG +HDOWK $GPLQLVWUDWLRQ 6WDQGDUG 6DIHW\ DQG +HDOWK 5HJXODWLRQVIRU&RQVWUXFWLRQ±/HDG ' (QYLURQPHQWDO 3URWHFWLRQ $JHQF\ &RGH RI )HGHUDO 5HJXODWLRQ 7LWOH 3DUW ,GHQWLILFDWLRQDQG/LVWLQJRI+D]DUGRXV:DVWH ( &RGHRI&DOLIRUQLD5HJXODWLRQV7LWOH6HFWLRQ/HDG ) &DOLIRUQLD/DERU&RGH6HFWLRQ/HDGUHODWHGFRQVWUXFWLRQZRUN 5(/$7(':25.63(&,),('(/6(:+(5( $ 6HFWLRQ ([LVWLQJ&RQGLWLRQ,QIRUPDWLRQ % 6HFWLRQ /HDG%DVHG3DLQW5HPHGLDWLRQ & 6HFWLRQ 6WHHO:DWHU6WRUDJH7DQN3DLQWLQJ 48$/,),&$7,216 $ 6RFLHW\IRU3URWHFWLYH&RDWLQJV 663& 4XDOLILFDWLRQ3URFHGXUH 43 D 43)LHOGDSSOLFDWLRQWRFRPSOH[LQGXVWULDODQGPDULQHVWUXFWXUHV E 43)LHOG5HPRYDORI+D]DUGRXV&RDWLQJV % &DOLIRUQLD 'HSDUWPHQW RI 3XEOLF +HDOWK &'3+ /HDG 5HODWHG &RQVWUXFWLRQ /5& VXSHUYLVRUVDPSOLQJSURMHFWPRQLWRULQJDQGZRUNHUFHUWLILFDWLRQV & (QYLURQPHQWDO 3URWHFWLRQ $JHQF\ /HDG %DVHG 3DLQW $EDWHPHQW 3URJUDP ± ,QVSHFWRU &HUWLILFDWLRQ Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 6(&7,21 /($'%$6('3$,175(0(',$7,21 (/0$1'6.</,1(67((/ 5(6(592,5&2$7,1*352-(&7 &2175$&7$ ' &DOLIRUQLD'HSDUWPHQWRI7R[LF6XEVWDQFHV&RQWUROFHUWLILHGODERUDWRU\WRSHUIRUPWR[LF FKDUDFWHULVWLFOHDFKLQJSURFHGXUHIRUOHDG '(),1,7,216 $ 'HILQLWLRQVRI3DLQWLQJ7HUPV $670'XQOHVVRWKHUZLVHVSHFLILHG % +D]DUGRXV:DVWH +D]DUGRXVVXEVWDQFHVDVGHILQHGLQ(3$5HJXODWLRQ&)5DQG DVGHILQHGE\DSSOLFDEOHVWDWHDQGORFDOUHJXODWLRQV 68%0,77$/6 $ &RPSO\ZLWKUHTXLUHPHQWVRI6HFWLRQ±Submittals RIWKH*HQHUDO3URYLVLRQV % )LUPDQGLQGLYLGXDOFHUWLILFDWLRQVRIDOOSHUVRQQHOVWDIIHGIRUSURMHFWDQGGHVFULSWLRQRIWKHLU DVVLJQPHQWV VDPSOLQJPRQLWRULQJDEDWHPHQWZRUNHUHWF $OOTXDOLILFDWLRQVVSHFLILHGLQ WKLVVHFWLRQVKDOOEHSURYLGHGE\WKHFRQWUDFWRU & /DERUDWRU\ 6XEPLWWKHQDPHDGGUHVVWHOHSKRQHQXPEHUDQGFHUWLILFDWLRQRIWKHWHVWLQJ ODERUDWRU\7KHODERUDWRU\VKDOOEHDFFUHGLWHGE\WKH6WDWHRI&DOLIRUQLD'HSDUWPHQWRI 7R[LF6XEVWDQFH&RQWURO '76& WRSHUIRUP7R[LF&KDUDFWHULVWLF/HDFKLQJ3URFHGXUH 7&/3 IRUOHD 3$57 0$7(5,$/6±12786(' 3$57 (;(&87,21 6$)7(<0($685(6 $ 3HUIRUPDOOZRUNLQDFFRUGDQFHZLWKORFDOEXLOGLQJFRGHV)HGHUDO,QGXVWULDO6DIHW\2UGHUV DQGUHTXLUHPHQWVRI&DO26+$3HUVRQQHOZRUNLQJRQRULQGLUHFWYLFLQLW\RIUHPRYLQJRU KDQGOLQJOHDGEDVHGSDLQWVKDOOZHDUSURWHFWLYHRXWHUZHDUH\HZHDUDQGUHVSLUDWRUVLQ DFFRUGDQFHZLWK&DO26+$7LWOH6HFWLRQ % 3URYLGHVDIHJXDUGVWRSXEOLFDQGSHUVRQQHOVDIHW\LQFOXGLQJZDUQLQJVLJQVIHQFHVOLJKWV DQGRWKHUVLPLODULWHPVWKDWDUHQHFHVVDU\IRUWKHSURWHFWLRQRIDOOSHUVRQQHOGXULQJWKH VDPSOLQJUHPRYDODQGKDQGOLQJRIOHDGEDVHGSDLQW (19,5210(17$/3527(&7,21 $ &RPSO\ZLWKDOOSURYLVLRQVRIIHGHUDOVWDWHDQGORFDOVWDWXWHVRUGLQDQFHVDQGUHJXODWLRQV FRQFHUQLQJHQYLURQPHQWDOSROOXWLRQDQGWKHSUHVHUYDWLRQRIQDWXUDOUHVRXUFHV Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 6(&7,21 /($'%$6('3$,175(0(',$7,21 (/0$1'6.</,1(67((/ 5(6(592,5&2$7,1*352-(&7 &2175$&7$ 6$03/,1*352&('85(6 $ 7KH&RQWUDFWRUVKDOOSURYLGHWKHLQLWLDOQRWLFHRIVDPSOLQJLQWKHLUEDVHOLQHVFKHGXOH ZHHNORRNDKHDGVFKHGXOHDQGFRQILUPWHVWLQJDFWLYLWLHVWRWKH'LVWULFWDWOHDVWKRXUV SULRUWRVDPSOLQJ % 3HUVRQQHODVVLJQHGWRVDPSOLQJVKDOOFDUU\WKHTXDOLILFDWLRQVOLVWHGLQWKLVVHFWLRQ3URRI RIFHUWLILFDWLRQVKDOOEHVXEPLWWHGWRWKH'LVWULFWSULRUWRVDPSOLQJ & )RXUVDPSOHVRIWKHOHDGSDLQWDEUDVLYHEODVWLQJZDVWHPDWHULDOVKDOOEHWDNHQIURPHDFK WDQNZKLOHLQWKHSUHVHQFHRIWKH'LVWULFW¶VUHSUHVHQWDWLYH6DPSOHVVKDOOEHWDNHQDWWKH IROORZLQJORFDWLRQV D ([WHULRUURRI E ([WHULRUWDQNVLGH F ,QWHULRUURRI G ,QWHULRUWDQNVLGH ' 6DPSOHVVKDOOEHFROOHFWHGZLWKFOHDQSODVWLFVFRRSVDQGSODFHGLQSUHFOHDQHGR] JODVVERWWOHV/RJVGHVFULELQJVDPSOLQJDFWLYLWLHVVKDOOEHSUHSDUHGDQGODEHOVVKDOOEH DWWDFKHGWRHDFKVDPSOHERWWOHDQGVKDOOLQFOXGHDVDPLQLPXPWKH6XEFRQWUDFWRU V QDPHGDWHWLPHORFDWLRQDQGSHUVRQQHOWDNLQJWKHVDPSOH ( )LHOGVDPSOH&KDLQRI&XVWRG\UHFRUGVVKDOOEHPDLQWDLQHGGXULQJWKHVDPSOLQJ$OO FROOHFWHGVDPSOHVVKDOOEHGHOLYHUHGWRDFHUWLILHGODERUDWRU\IRUWHVWLQJXQGHU&KDLQRI &XVWRG\SURWRFROV 7(67,1*0(7+2'6 $ 7KH6XEFRQWUDFWRUVKDOOWHVWWKHDEUDVLYHEODVWLQJZDVWHPDWHULDOIRUPHWDOVXVLQJWKHWHVW PHWKRGGHVFULEHGLQ&)57HVWLQJIRUPHWDOVVKDOOEHDFFRPSOLVKHGE\D'76& FHUWLILHGODERUDWRU\ 5(68/76 $ 6XEPLWWKHPHWDOWHVWUHVXOWVIRUWKHDEUDVLYHEODVWLQJZDVWHPDWHULDO,IWKHPHWDOFRQWHQW RIWKHPDWHULDOLVDWDFRQFHQWUDWLRQORZHUWKDQWKHDOORZDEOHFRQFHQWUDWLRQDVGHILQHGE\ '76&WKHPDWHULDOVKDOOEHFRQVLGHUHGQRQKD]DUGRXVDQGVKDOOEHGLVSRVHGRI DFFRUGLQJO\,IWKHPHWDOFRQWHQWRIWKHPDWHULDOLVDWDFRQFHQWUDWLRQHTXDOWRRUJUHDWHU WKDQWKHUHVSHFWLYHYDOXHDVGHILQHGE\'76&WKHZDVWHVKDOOEHFRQVLGHUHGKD]DUGRXV % 7KH&RQWUDFWRUVKDOOVXEPLWWKUHHFRSLHVRIWKHODERUDWRU\UHVXOWVIRUDOOOHDGWHVWV & 7KHHQWLUHW\RIWKHWDQN¶VH[WHULRUFRDWLQJZLOOEHFRQVLGHUHGKD]DUGRXVLIHLWKHURIWKHWZR H[WHULRUVDPSOHSRLQWVH[FHHGKD]DUGRXVOHYHOVRIOHDGRUFKURPLXP ' 7KHHQWLUHW\RIWKHWDQN¶VLQWHULRUFRDWLQJZLOOEHFRQVLGHUHGKD]DUGRXVLIHLWKHURIWKHWZR LQWHULRUVDPSOHSRLQWVH[FHHGKD]DUGRXVOHYHOVRIOHDGRUFKURPLXP Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 6(&7,21 /($'%$6('3$,175(0(',$7,21 (/0$1'6.</,1(67((/ 5(6(592,5&2$7,1*352-(&7 &2175$&7$ +$=$5'286:$67(',6326$/ $ 2EWDLQDKD]DUGRXVZDVWHJHQHUDWRUSHUPLWLIWKHZDVWHLVGHWHUPLQHGWREHKD]DUGRXV % +DQGOHWUDQVSRUWDQGGLVSRVHRIWKHKD]DUGZDVWHLQDFFRUGDQFHZLWKDOO DSSOLFDEOH IHGHUDOVWDWHDQGORFDOUHJXODWLRQV & &RQWUDFWRUVKDOOEHUHVSRQVLEOHIRUDOOQHFHVVDU\SHUPLWVIHHVDQGGLVSRVDOFRVWV (1'2)6(&7,21 Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 6(&7,21 /($'%$6('3$,175(029$/$1'',6326$/ (/0$1'6.</,1(67((/ 5(6(592,5&2$7,1*352-(&7 &2175$&7$ 3$57 *(1(5$/ '(6&5,37,21 $ 7KHZRUNLQWKLVVHFWLRQUHJDUGVWKHUHPRYDORIOHDGEDVHGSDLQWIURPVWHHOUHVHUYRLUV 7KHH[WHULRUEDVHFRDWIRU(OPDQG6N\OLQHVWHHOUHVHUYRLUVKDYHSUHYLRXVO\WHVWHGIRU KD]DUGRXVOHYHOVRIOHDGDQGFKURPLXP7KHFRQWUDFWRUVKDOODVVXPHLQWKHLUELGWKDWWKH H[WHULRUFRDWLQJIRU(OPDQG6N\OLQHWDQNVFRQWDLQKD]DUGRXVPDWHULDO/HDGEDVHGSDLQW UHPRYDODQGDEDWHPHQWIRUWKHH[WHULRUFRDWLQJVVKDOOEHLQDFFRUGDQFHZLWKWKLVVHFWLRQ DQGDOODSSOLFDEOHIHGHUDODQGVWDWHUHTXLUHPHQWV 5()(5(1&(6 $ 2FFXSDWLRQDO6DIHW\DQG+HDOWK$GPLQLVWUDWLRQ6WDQGDUG 6DIHW\DQG+HDOWK 5HJXODWLRQVIRU&RQVWUXFWLRQ±/HDG % (QYLURQPHQWDO3URWHFWLRQ$JHQF\&RGHRI)HGHUDO5HJXODWLRQ7LWOH3DUW ,GHQWLILFDWLRQDQG/LVWLQJRI+D]DUGRXV:DVWH & &RGHRI&DOLIRUQLD5HJXODWLRQV7LWOH6HFWLRQ/HDG ' &DOLIRUQLD/DERU&RGH6HFWLRQ/HDGUHODWHGFRQVWUXFWLRQZRUN ( $670'6WDQGDUG7HVW0HWKRGIRU,QGLFDWLQJ2LORU:DWHULQ&RPSUHVVHG$LU ) (3$7HVW0HWKRG±7R[LFLW\&KDUDFWHULVWLF/HDFKLQJ3URFHGXUH * 6RFLHW\IRU3URWHFWLYH&RDWLQJV 663& 6XUIDFH3UHSDUDWLRQ 63 1HDU:KLWH%ODVW &OHDQLQJ 5(/$7(':25.63(&,),('(/6(:+(5( $ 6HFWLRQ ([LVWLQJ&RQGLWLRQ,QIRUPDWLRQ % 6HFWLRQ /HDG%DVHG3DLQW5HPHGLDWLRQ & 6HFWLRQ &RDWLQJRI:HOGHG6WHHO:DWHU6WRUDJH7DQN 48$/,),&$7,216 $ 6RFLHW\IRU3URWHFWLYH&RDWLQJV 663& 4XDOLILFDWLRQ3URFHGXUH 43 D 43)LHOGDSSOLFDWLRQWRFRPSOH[LQGXVWULDODQGPDULQHVWUXFWXUHV E 43)LHOG5HPRYDORI+D]DUGRXV&RDWLQJV % &DOLIRUQLD 'HSDUWPHQW RI 3XEOLF +HDOWK &'3+ /HDG 5HODWHG &RQVWUXFWLRQ /5& VXSHUYLVRUVDPSOLQJSURMHFWPRQLWRULQJDQGZRUNHUFHUWLILFDWLRQV Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 6(&7,21 /($'%$6('3$,175(029$/$1'',6326$/ (/0$1'6.</,1(67((/ 5(6(592,5&2$7,1*352-(&7 &2175$&7$ & (QYLURQPHQWDO3URWHFWLRQ$JHQF\/HDG%DVHG3DLQW$EDWHPHQW3URJUDP±VXSHUYLVRU SURMHFWGHVLJQHUDEDWHPHQWZRUNHUFHUWLILFDWLRQ '(),1,7,216 $ 'HILQLWLRQVRI3DLQWLQJ7HUPV $670'XQOHVVRWKHUZLVHVSHFLILHG % +D]DUGRXV:DVWH +D]DUGRXVVXEVWDQFHVDVGHILQHGLQ(3$5HJXODWLRQ&)5DQG DVGHILQHGE\DSSOLFDEOHVWDWHDQGORFDOUHJXODWLRQV & 6HOI&RQWDLQHG&ORVHG&LUFXLW%ODVW&OHDQLQJ(TXLSPHQW 6SHFLDOO\GHVLJQHGEODVW FOHDQLQJHTXLSPHQWVKDOOEHXWLOL]HGXVLQJHLWKHUGLUHFWSUHVVXUHRUVXFWLRQPHWKRG $EUDVLYHPHGLDDQGEODVWDLUVKDOOEHFRPSOHWHO\FRQWDLQHGZLWKLQWKHKRXVLQJVNQRZQDV VHOIFRQWDLQHGXQLWVZKLFKDUHKHOGLQGLUHFWFRQWDFWZLWKWKHZRUNSLHFH6SHQWDEUDVLYH DQGFRPSUHVVHGDLULVUHWXUQHGWRFROOHFWLRQDQGGXVWFRQWUROXQLWE\+(3$ILOWHUHG HQFORVHGYDFXXPOLQHVHOLPLQDWLQJGLVFKDUJHRIDQ\FRDWLQJGXVWRUSDUWLFOHVLQWRWKH HQYLURQPHQW 68%0,77$/6 $ 3ULRUWRUHPRYLQJDQ\FRDWHGVXUIDFHVXEPLWWKHUHVXOWVRIWKHOHDGDQDO\VLVIRUVDPSOHV WDNHQIURPWKHVWHHOUHVHUYRLULQDFFRUGDQFHZLWK6HFWLRQ % /HDGEDVHGDEDWHPHQWSODQLQFOXGLQJWKHIROORZLQJLQIRUPDWLRQ D 3ODQSUHSDUHUQDPHFRQWUDFWLQIRUPDWLRQDQGSURRIRI&'3+FHUWLILHGGHVLJQHU FHUWLILFDWLRQ E 1DPHFRQWDFWLQIRUPDWLRQDQGFHUWLILFDWLRQVRIWKH&DOLIRUQLD'HSDUWPHQWRI3XEOLF +HDOWK/HDG5HODWHG&RQVWUXFWLRQ&HUWLILHGOHDGVXSHUYLVRURUSURMHFWPRQLWRU F 3URRIRIFHUWLILFDWLRQIRUDOODEDWHPHQWZRUNHUVVWDIIHGIRUSURMHFW G $SSOLFDEOH SHUPLWV REWDLQHG IRU SURMHFW $OO IHHV DUH WKH UHVSRQVLELOLW\ RI WKH FRQWUDFWRUDQGVKDOOEHLQFOXGHGLQWKHELGSULFH H 'HVFULSWLRQRISURSRVHGOHDGEDVHGSDLQWUHPRYDOPHWKRGDQGHTXLSPHQWWREH XVHG I 6DIHW\ HTXLSPHQW DQG PHDVXUHV LQFOXGLQJ SHUVRQQHO VDIHW\ JHDU WHPSRUDU\ HQFORVXUHVZDUQLQJVLJQVIHQFHVHWFWREHXVHGDWWKHVLWH J 3DFNDJLQJPDWHULDOVWREHXVHGIRUVDIHVWRUDJHDQGWUDQVSRUWDWLRQRIUHPRYHG OHDGEDVHGSDLQW K 3URSRVHGOHDGEDVHGSDLQWGLVSRVDOORFDWLRQV & 0DQLIHVWORJRIKD]DUGRXVPDWHULDOGLVSRVDO (19,5210(17$/3527(&7,21 $ &RPSO\ZLWKDOOSURYLVLRQVRI)HGHUDO6WDWHDQGORFDOVWDWXWHVRUGLQDQFHVDQG UHJXODWLRQVFRQFHUQLQJHQYLURQPHQWDOSROOXWLRQDQGWKHSUHVHUYDWLRQRIQDWXUDOUHVRXUFHV Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 6(&7,21 /($'%$6('3$,175(029$/$1'',6326$/ (/0$1'6.</,1(67((/ 5(6(592,5&2$7,1*352-(&7 &2175$&7$ 3$57 0$7(5,$/6 $%5$6,9( $ $EUDVLYH)RU%ODVWLQJ 3URYLGHVKDUSVDOWIUHHDEUDVLYHPDWHULDOIUHHIURPIHOGVSDUDQG RWKHUFRQVWLWXHQWVWKDWWHQGWREUHDNGRZQDQGUHPDLQRQWKHVXUIDFH/HVVWKDQRQH SHUFHQW E\PDVV RIWKHDEUDVLYHVKDOOSDVVWKURXJKD1RVLHYH$EUDVLYHVKDOOQRW FRQWDLQPDJQHWLFPDWHULDOV7KHEODVWFOHDQLQJDEUDVLYHVKDOOEHGU\DQGIUHHRIRLO JUHDVHDQGRWKHUKDUPIXOPDWHULDOVDWWKHWLPHRIXVH&RQWUDFWRUVKDOOSURYLGHD FHUWLILFDWHRIFOHDQOLQHVVDQGFRPSOLDQFHIURPWKHDEUDVLYHPDQXIDFWXUHUIRUWKHDEUDVLYH PDWHULDOEHLQJXWLOL]HG % 5HF\FOHG$EUDVLYH 7KHH[LVWLQJH[WHULRUFRDWLQJFRQWDLQVOHDGWKHUHIRUHWKHDEUDVLYH VKDOOQRWEHUHF\FOHGWRDYRLGFRQWDPLQDWLRQDQGH[SRVXUHRIVXUURXQGLQJDUHDVDQG SHUVRQQHO &2035(66('$,5 $ &OHDQGU\FRPSUHVVHGDLUVKDOOEHXVHGIRUDOORIWKHDEUDVLYHEODVWLQJPHWKRGV VSHFLILHG0RLVWXUHVHSDUDWRUVRLOVHSDUDWRUVWUDSVRURWKHUHTXLSPHQWVKDOOEHSURYLGHG E\WKH6XEFRQWUDFWRUWRDFKLHYHWKLVUHTXLUHPHQW$LUFOHDQOLQHVVVKDOOEHYHULILHGDVSHU 6WDQGDUG7HVW0HWKRGIRU,QGLFDWLQJRLORU:DWHU,Q&RPSUHVVHG$LU$670' 9$&880),/7(56 $ )LOWHUVRQYDFXXPVVKDOOEHDEVROXWH HIILFLHQW +(3$ +LJK(IILFLHQF\ 3DUWLFXODWH$LU ILOWHUVDQG8/ODEHOHG&OHDQOLQHVVDQGHIILFLHQF\RI+(3$ILOWHUVVKDOO EHPDLQWDLQHGDQGPRQLWRUHGGDLO\E\WKHFRQWUDFWRUWRDYRLGDQ\SRVVLEOHFRQWDPLQDWLRQ RUH[SRVXUHRIOHDGFRQWDPLQDQWVWRWKHHQYLURQPHQWDQGHPSOR\HHV 3$57 (;(&87,21 3$,176$03/,1*$1'7(67,1* $ 3ULRUWRVWDUWLQJZRUNRQWKHSDLQWUHPRYDOSDLQWVDPSOHVVKDOOEHWDNHQRIWKHVWHHOWDQN LQDFFRUGDQFHZLWK6HFWLRQ % 3URYLGHVDIHJXDUGVWRSXEOLFDQGSHUVRQQHOVDIHW\LQFOXGLQJZDUQLQJVLJQVIHQFHVOLJKWV DQGRWKHUVLPLODULWHPVWKDWDUHQHFHVVDU\IRUWKHSURWHFWLRQRIDOOSHUVRQQHOGXULQJWKH VDPSOLQJUHPRYDODQGKDQGOLQJRIOHDGEDVHGSDLQW & 7KH&RQWUDFWRUVKDOOKDYHD6WDWHRI&DOLIRUQLD'HSDUWPHQWRI7R[LF6XEVWDQFH&RQWURO '76& FHUWLILHGODEFRQGXFWD7R[LF&KDUDFWHULVWLF/HDFKLQJ3URFHGXUH 7&/3 DQDO\VLV IRUOHDGRQHDFKVDPSOHLQDFFRUGDQFHZLWK'76&UHTXLUHPHQWV7KH&RQWUDFWRUVKDOO VXEPLWWKHODEV¶FHUWLILFDWLRQVIRU'LVWULFWDSSURYDOSULRUWRVDPSOLQJDQGWHVWLQJ Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 6(&7,21 /($'%$6('3$,175(029$/$1'',6326$/ (/0$1'6.</,1(67((/ 5(6(592,5&2$7,1*352-(&7 &2175$&7$ ' ,IWKHVDPSOHVDUHFRQVLGHUHGKD]DUGRXVFRQGXFWWKHSDLQWUHPRYDODQGKDQGOLQJ RSHUDWLRQVDFFRUGLQJO\DQGVHJUHJDWHWKHEODVWZDVWHIURPWKHOHDGDQGQRQOHDGEDVHG SDLQWDUHDV&RQWUDFWRUVKDOODYRLGH[FHVVDFFXPXODWLRQRIZDVWHVRQVLWHDVGHWHUPLQHG DQGGLUHFWHGE\WKH'LVWULFW$&HUWLILHG0DQLIHVWVKDOOEHSURYLGHGIRUWKHGLVSRVDORI EODVWZDVWH 6$)7(< $ 6DIHW\LVWKHVROHUHVSRQVLELOLW\RIWKH&RQWUDFWRU % &RPSO\ZLWKDOOSURYLVLRQVRIIHGHUDOVWDWHDQGORFDOVWDWXWHVRUGLQDQFHVDQGUHJXODWLRQV FRQFHUQLQJHQYLURQPHQWDOSROOXWLRQDQGWKHSUHVHUYDWLRQRIQDWXUDOUHVRXUFHV & :DUQLQJ6LJQVDQG/DEHOV 3URYLGHZDUQLQJVLJQVDWDSSURDFKHVWRWKHOHDGFRQWURODUHD 3URYLGHDQGDIIL[ODEHOVWRLPSHUPHDEOHEDJVZDVWHGUXPVDQGRWKHUFRQWDLQHUV FRQWDLQLQJOHDGPDWHULDOVVFUDSZDVWHRUGHEULVZKHQUHTXLUHGE\UHJXODWLRQV6LJQV DQGODEHOVVKDOOFRPSO\ZLWKDSSOLFDEOH/RFDO6WDWHDQG)HGHUDOUHTXLUHPHQWV 0(7+2'6 $ 3UH&OHDQLQJ0HWKRGV 3ULRUWRDEUDVLYHEODVWRSHUDWLRQVDOOLQWHULRUDQGH[WHULRUVXUIDFHV ZKLFKZLOOEHDEUDVLYHEODVWHGZLWKRLO\RUJUHDV\VXUIDFHFRQWDPLQDQWVVKDOOEHFOHDQHG LQDFFRUGDQFHZLWK663&636ROYHQW&OHDQLQJ % 5HTXLUHG0HWKRGRI/HDG&RQWDLQLQJ3DLQW5HPRYDO 6HOI&RQWDLQHG&ORVHG&LUFXLW%ODVW &OHDQLQJHTXLSPHQWLVUHTXLUHGIRUOHDGFRQWDLQLQJSDLQWUHPRYDO6HOI&RQWDLQHG&ORVHG &LUFXLW%ODVW&OHDQLQJVXEVWDQWLDOO\GHFUHDVHVWKHGXVWOHDGKD]DUGDQGDXWRPDWLFDOO\ UHFRYHUVWKHDEUDVLYHPHGLDDQGPDWHULDOEHLQJUHPRYHGLQWRVHOIFRQWDLQHGHQFORVHG GLVSRVDOFRQWDLQHUV & $EUDVLYH%ODVWLQJ0HWKRGV $Q\RIWKHIROORZLQJPHWKRGVRIVXUIDFHSUHSDUDWLRQPD\EH XVHGWRDFKLHYHD1HDU:KLWH%ODVW&OHDQHGVXUIDFHSHU6RFLHW\IRU3URWHFWLYH&RDWLQJV 3XEOLFDWLRQ663&63 D 'U\DEUDVLYHEODVWLQJXVLQJFRPSUHVVHGDLUEODVWQR]]OHVDQGDEUDVLYH E 'U\DEUDVLYHEODVWLQJXVLQJDFORVHGF\FOHUHFLUFXODWLQJDEUDVLYHV\VWHPZLWK FRPSUHVVHGDLUEODVWQR]]OHDQGDEUDVLYHZLWKRUZLWKRXWYDFXXPIRUGXVWDQG DEUDVLYHUHFRYHU\ :25.352&('85(6 $ 3URFHGXUHVIRUOHDGFRQWDLQLQJSDLQWDEDWHPHQW 3HUIRUPDOOZRUNLQDFFRUGDQFHZLWK DSSOLFDEOH6WDWHDQG)HGHUDOUHJXODWLRQVJRYHUQLQJVXFKZRUN Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 6(&7,21 /($'%$6('3$,175(029$/$1'',6326$/ (/0$1'6.</,1(67((/ 5(6(592,5&2$7,1*352-(&7 &2175$&7$ % 3URFHGXUHV)ROORZLQJ/HDG&RQWDLQLQJ3DLQW5HPRYDO $OOYLVLEOHUXVWRURWKHU GHWHULRUDWLRQWKDWIRUPVRQWKHVXUIDFHRIWKHVWHHODIWHUEODVWFOHDQLQJVKDOOEHUHPRYHG E\UHEODVWLQJWKHUXVWHGDUHDVLQDFFRUGDQFHZLWK663&63DQGLQVSHFWLRQVKDOOEH ZLWQHVVHGDQGYHULILHGE\WKH'LVWULFWRULW¶VUHSUHVHQWDWLYH &/($183$1'',6326$/ $ &RYHUWKHJURXQGVXUIDFHZLWK9LVTXHHQRURWKHUVXLWDEOHLPSHUPHDEOHPDWHULDOWR SURWHFWWKHVRLOIURPFRQWDPLQDWLRQZLWKOHDG0DLQWDLQWKHJURXQGFRYHULQJVRWKDWWKH JURXQGLVFRYHUHGDWDOOWLPHVXQWLOWKHEODVWLQJLVFRPSOHWHG % &OHDQXS 0DLQWDLQVXUIDFHVRIWKHOHDGFRQWURODUHDIUHHRIDFFXPXODWLRQVRIDEUDVLYHEODVW PDWHULDOSDLQWFKLSVGXVWDQGGHEULV7KH&RQWUDFWRUVKDOOFRQGXFWDGDLO\LQVSHFWLRQDQG PDLQWDLQFOHDQOLQHVVRIMREVLWHLQDFFRUGDQFHZLWKWKH'LVWULFW¶VUHFRPPHQGDWLRQV$Q\ DFFXPXODWLRQ RU GLVFUHSDQFLHV LGHQWLILHG VKDOO EH LPPHGLDWHO\ DGGUHVVHG SULRU WR SURFHHGLQJZLWKDQ\SURGXFWLRQ5HVWULFWWKHVSUHDGRIGXVWDQGGHEULV NHHSZDVWHIURP EHLQJGLVWULEXWHGRYHUWKHJHQHUDODUHD'RQRWGU\VZHHSWKHDUHD:KHQWKHSDLQW UHPRYDORSHUDWLRQKDVEHHQFRPSOHWHGWKHDUHDVKDOOEHFOHDQHGRIDOOYLVLEOHOHDGSDLQW FRQWDPLQDWLRQ E\ YDFXXPLQJ ZLWK D +(3$ ILOWHUHG YDFXXP FOHDQHUIROORZHG E\ ZHW PRSSLQJ RIQRQVRLOVXUIDFHV LIYDFXXPLQJLVQRWHIIHFWLYH([WUDFDUHVKDOOEHWDNHQWR FRYHU DQG FRPSOHWHO\ VHDO DQ\ DQG DOO VWRUP GUDLQV WR DYRLG FRQWDPLQDWLRQ DQG DFFXPXODWLRQIURPDEUDVLYHEODVWRSHUDWLRQV6XPSVDQGGUDLQVXSSO\SLSHVRQWKHLQWHULRU RIWKHUHVHUYRLUVKDOODOVREHFRYHUHGRUSURWHFWHGDVWRDYRLGXQZDQWHGDFFXPXODWLRQRI DEUDVLYHLQKDUGWRUHDFKRULQDFFHVVLEOHDUHDV & 'XVWDQG/RRVH5HVLGXHV 'XVWDQGUHVLGXHVKDOOEHUHPRYHGIURPSUHSDUHGVXUIDFHVE\ YDFXXPFOHDQLQJRUZHWPRSSLQJ9DFXXPHTXLSPHQWVKDOOEHHTXLSSHGZLWK+(3$ ILOWHUV ' 2EWDLQDKD]DUGRXVZDVWHJHQHUDWRUSHUPLWLIWKHZDVWHLVGHWHUPLQHGWREHKD]DUGRXV ( +DQGOHWUDQVSRUWDQGGLVSRVHRIWKHKD]DUGZDVWHLQDFFRUGDQFHZLWKDOODSSOLFDEOH IHGHUDOVWDWHDQGORFDOUHJXODWLRQV ) &RQWUDFWRUVKDOOEHUHVSRQVLEOHIRUDOOQHFHVVDU\SHUPLWVIHHVDQGGLVSRVDOFRVWV * 'LVSRVDORI3DLQW'XVWDQG$EUDVLYH%ODVW0DWHULDO 3URSHUO\GLVSRVHRIUHPRYHGSDLQW GXVWDQGDEUDVLYHEODVWPDWHULDOWRDQDXWKRUL]HGGLVSRVDOVLWH3URYLGHZULWWHQPDQLIHVW RIWUDQVIHUWRWKH'LVWULFW + 'LVSRVDORI1RQKD]DUGRXV0DWHULDOV 5HPRYHGHEULVVFUDSVZDVWHPDWHULDOVUXEELVK DQGWUDVKQRWFODVVLILHGDVDKD]DUGRXVZDVWHIURPWKHLPPHGLDWHZRUNDUHDDQGSODFHLQ GRXEOHSODVWLFEDJVDQGOHJDOO\UHPRYHGIURPWKHVLWHDWWKHHQGRIHDFKGD\ (1'2)6(&7,21 Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 SECTION 099713 STEEL WATER STORAGE TANK COATING ELM AND SKYLINE STEEL RESERVOIR COATING PROJECT CONTRACT 5024-3A 099713-1 PART 1 – GENERAL 1.1 DESCRIPTION A. This specification describes the requirements for surface preparation, application of protective coatings, curing, disinfection, water quality testing and the return of steel water storage tanks back to service. B. Tank coating materials and operations shall conform with AWWA D102 and as hereinafter specified. C. Work to be accomplished includes surface preparation, application of protective linings and coatings to interior and exterior surfaces, coordination with District inspector for monitoring and inspection of all surface preparation and coatings, testing of coatings, and all related work including handling of non-hazardous materials/wastes, installation of best management practices and environmental controls, and other work necessary to provide a complete coating system for the tank and all appurtenances, generally as follows: 1. Submit E-28 shutdown request form to District representative at least two weeks prior to the requested shutdown date. Elm and Skyline tanks shall be completed in consecutive order with only one tank taken out of service at a given time. The tank shall be returned to service prior to progressing to the next tank in series. 2. Remove and/or cover appurtenances not scheduled for coating. Such equipment includes, but is not limited to, water level indicator, signage, and electrical conduit. 3. Complete scheduled removals (interior ladder, tie down rods) and install appurtenances (interior bend fitting, safety railing, test port replacement, tie-down rods, etc.) scheduled for each tank. 4. Shim roof rafters to access void area between roof and rafter. 5. Test and abate lead based paint on tank exterior. Dispose of hazardous wastes generated in conformance with all regulations. 6. Abrasively blast per SSPC – SP10 all interior and exterior areas scheduled for coating. 7. Grind and clean corroded/damaged rafters. Remove damaged sealants/caulking. Route and clean surface area. 8. Wash down areas scheduled for coating. 9. Apply primer to all interior surfaces previously blast cleaned and apply coating system. Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 SECTION 099713 STEEL WATER STORAGE TANK COATING ELM AND SKYLINE STEEL RESERVOIR COATING PROJECT CONTRACT 5024-3A 099713-2 10. Conduct holiday testing of coating system and repair. Remove rafter shims once complete. 11. Apply a flexible sealant to all circumferential shell/roof connections, roof plate lap seams, and other crevices/voids that inhibit the coating application. 12. Apply primer to all exterior surfaces previously blast cleaned and then apply coating system. 13. Cure applied coatings. 14. Replace roof vent screens. Reinstall previously removed appurtenances. Remove covers from appurtenances not scheduled for coating. 15. Wash down coated interior surfaces. Disinfect complete interior of potable service tanks. Complete two rounds of Bac-T and VOC testing prior to returning tank to service. 16. Test, handle and dispose of any non-hazardous wastes generated from coating operations in conformance with all regulations. 1.2 REFERENCED SPECIFICATIONS AND STANDARDS A. Except as otherwise indicated, the current editions of the following apply to the Work of this Section. 1. American Society for Testing and Materials (ASTM) ASTM D3359, Standard Test Method for Measuring Adhesion by Tape. ASTM D4138, Standard Test Method for Measurement of Dry Paint Thickness of Protective Coating Systems by Destructive Means ASTM D4285, Standard Test Method for Indicating Oil or Water in Compressed Air ASTM D4414, Standard Practice for Measurement of Wet Film Thickness by Notch Gages ASTM D4417, Standard Test Methods for Field Measurement of Surface Profile of Blast Cleaned Steel ASTM D5402, Standard Test Methods for Assessing the Solvent Resistance of Organic Coatings Using Solvent Rubs ASTM D7091, Standard Practice for Nondestructive Measurement of Dry Film Thickness of Nonmagnetic Coatings Applied to Ferrous Metals and Nonmagnetic, Nonconductive Coatings Applied to Non-Ferrous Metals ASTM E337, Standard Test Method for Measuring Humidity with a Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 SECTION 099713 STEEL WATER STORAGE TANK COATING ELM AND SKYLINE STEEL RESERVOIR COATING PROJECT CONTRACT 5024-3A 099713-3 Psychrometer 2. American Water Works Association (AWWA) AWWA D102, AWWA Standard for Coating Steel Water Storage Tanks AWWA C652, AWWA Standard for Disinfection of Water Storage Facilities AWWA M42, AWWA Manual of Water Supply Practices, Steel Water Storage Tanks 3. SSPC: Society for Protective Coatings (SSPC) SSPC-SP 1, Solvent Cleaning SSPC-SP 2, Hand Tool Cleaning SSPC-SP 3, Power Tool Cleaning SSPC-SP 6, Commercial Blast Cleaning SSPC-SP 7, Brush-off Blast Cleaning SSPC-SP 10, Near-White Blast Cleaning SSPC-SP 11, Power Tool Cleaning to Bare Metal SSPC-SP 15, Power Tool Cleaning to Commercial Grade Cleanliness SSPC-PA 1, latest revision, for "Shop, Field and Maintenance Painting SSPC-PA 2, Measurement of Dry Film Thickness with Magnetic Gages SSPC-VIS 1, Visual Standard for Abrasive Blast Cleaned Steel SSPC-VIS 3, Visual Standard for Hand and Power Tool Cleaned Steel SSPC Publication No. 91-12, Coating and Lining Inspection Manual SSPC-Visual Comparison Manual SSPC Guide 6-2021 - Guide for Containing Surface Preparation Debris Generated During Paint Removal Operations SSPC Guide 12 - Guide for Illumination of Industrial Painting SSPC's Publication 91-12, Testing Recirculated Abrasives 4. NACE International (NACE) Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 SECTION 099713 STEEL WATER STORAGE TANK COATING ELM AND SKYLINE STEEL RESERVOIR COATING PROJECT CONTRACT 5024-3A 099713-4 NACE SP 0178, Standard Recommended Practice for fabrication Details, Surface Finish Requirements, and Proper Design Considerations for Tanks and Vessels to be Lined for Immersion Service. NACE SP 0188, Standard Recommended Practice for Discontinuity (Holiday) Testing of Protective Coatings 5. Painting and Decorating Contractors of America (PDCA) PDCA P2-04, Third Party Inspections: Qualifications, Responsibilities and Procedures. 6. U.S. Code of Federal Regulations 29 CFR 1926.55, Gases, Vapors, Fumes, Dusts, and Mists 29 CFR 1926.57, Safety and Health Regulations for Construction, Subpart D – Occupational Health and Environmental Controls (Ventilation) 7. California Code of Regulations 8CCR 5157, Permit Required Confined Spaces 8. National Sanitation Foundation (NSF) NSF 61 Drinking Water System Components – Health Effects NSF 600 Health Effects Solvent Criteria 1.3 SUBMITTALS A. The following shall be submitted in accordance with the General Provisions: 1. Qualifications of the Contractor and key personnel and project references (to be submitted with the bid). 2. Qualifications of the Contractor’s coating inspector and Certified Industrial Hygienist. 3. Health and Safety Plan, including surface preparation and coating operations. 4. Quality control plan for field coating operations and schedule of field coating activities. 5. Containment system for exterior abrasive blasting and coating operations. 6. Dehumidification and ventilation plan. Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 SECTION 099713 STEEL WATER STORAGE TANK COATING ELM AND SKYLINE STEEL RESERVOIR COATING PROJECT CONTRACT 5024-3A 099713-5 7. Equipment to be used for the measurement of dry film thickness, surface anchor profile, holiday detection, temperature and dew point. 8. Manufacturer’s paint color charts. 9. Product data and material safety data sheets for coating systems including, but not limited to paints, thinners, solvents, rust inhibitors and/or cleaning fluids. 10. Proof of certification of abrasive blast media from the California Air Resources Board list of Abrasive Blasting - Current Certified Abrasives. 11. Copy of regulatory agency permits that apply to the work of this Contract. 12. Product information for all appurtenances proposed for installation. 1.4 DEFINITIONS Action Level: Employee exposure, without regard to the use of respirators, to an airborne concentration of a contaminant in milligrams per cubic meter (mg/m3) or micrograms per cubic meter of air (ȝg/m3) calculated as an eight-hour Time Weighted Average (TWA). Unless otherwise specified by regulation, the Action Level of a material will be equivalent to one-half of the U.S. Department of Labor, Occupational Safety and Health Administration (OSHA) Permissible Exposure Limit (PEL) for that substance. Air Flow: In this guide, “air flow” refers to the rate or movement of air (i.e., foot per minute [ft/min]) in a given direction such as cross- or down-draft. Also referred to as “air velocity” or “air movement.” Coating: Protective materials used or applied on interior or exterior surfaces, or any protective material in general. Containment System: Cover panels, screens, tarps, scaffolds, supports and shrouds used to enclose an entire work area or a paint removal tool to minimize or prevent the debris generated during surface preparation from entering the environment, and to facilitate the controlled collection of the debris for disposal. Containment systems may also employ the use of ground covers or water booms. Emissions: Airborne plumes of material including abrasive media, paint chips and debris as well as spills or leaks of water. Engineering Controls: A device or system designed and implemented to restrict or abate occupational health and safety hazards at their source (e.g., ventilation to remove air contaminants, acoustical enclosure of noisy equipment). Exterior Surfaces: Exterior surfaces, excluding inaccessible areas, of the tank roof, shell, accessories and appurtenances that are exposed to the elemental atmosphere. Hazardous and Toxic Substances: Substances defined by OSHA as chemicals present in the workplace that are capable of causing harm. The term “chemicals” includes dusts, mixtures, and common materials such as paints, fuels, and solvents. Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 SECTION 099713 STEEL WATER STORAGE TANK COATING ELM AND SKYLINE STEEL RESERVOIR COATING PROJECT CONTRACT 5024-3A 099713-6 Impenetrable: Impervious to dust and wind. Impermeable: Impervious to water. Inaccessible Areas: Areas of the finished structure that, by virtue of the configuration of the completed structure, cannot be accessed to perform surface preparation or coating application (with or without the use of scaffolding, rigging, or staging). Inaccessible areas include such areas as the contact surfaces of roof plate lap joints, underside of roof plates where they cross supporting members, contact surfaces of bolted connections, underside of column base plates, contact surfaces of mating parts not intended to be removed or disassembled during routine operation or maintenance of the tank, and underside of the tank bottom for ground-supported flat-bottom tanks. Interior Surfaces: Surfaces of the tank or its appurtenances, accessories and appurtenances, that are exposed to the stored water or its vapor. Examples are the surfaces of the roof, support columns, space between roof and rafter, shell and bottom within the tank. Lining: Protective materials used or applied to interior surfaces. Manufacturer: The party that manufactures, fabricates, or produces materials or products. Negative Air Pressure: Air pressure inside a structure (e.g., containment) that is less than the air pressure outside the structure. Paint: Protective materials used or applied on exterior surfaces. Permissible Exposure Limit (PEL): PEL refers to employee exposure, without regard to the use of respirators, to an airborne concentration of a contaminant in micrograms per cubic meter of air (ȝg/m3) calculated as an eight-hour time-weighted average (TWA). A formula is used to calculate the PEL if an employee is exposed to lead or any other contaminant for more than eight hours in any workday. PM-10: Particulate matter (dust) less than 10 ȝm (0.39 mils) in aerodynamic equivalent diameter. (Aerodynamic equivalent diameter is defined as the diameter of a unit density sphere having the same settling velocity as the particle in question, regardless of its shape and density.) Potable water: Water that is safe and satisfactory for drinking and cooking. Pot-life: The time period, after mixing the components together, that the coating remains usable with no decrease in the desired properties or performance. Static Pressure: The pressure exerted by a liquid or gas, especially water or air, on a body at rest. As used herein, “static pressure” refers to the amount of pressure measured in inches of water when air moves through an object, such as duct work. Stripe Coat: a coat of paint applied to specified areas such as edges or welds before or after a full coat is applied to the entire surface. Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 SECTION 099713 STEEL WATER STORAGE TANK COATING ELM AND SKYLINE STEEL RESERVOIR COATING PROJECT CONTRACT 5024-3A 099713-7 Time Weighted Average (TWA): Concentrations of airborne toxic materials that have been weighted for a certain time duration, usually eight hours. Ventilation System: A method of providing air movement across a work area by either natural or mechanical means. Ventilation systems include both natural ventilation and mechanical ventilation (fans, hoods, and duct work) to provide air movement across the work area, and dust collectors to clean the discharged air. 1.5 QUALIFICATIONS A. The Contractor shall be a licensed Painting and Decorating Contractor in the State of California (C-33 Classification) and have a minimum of five (5) years of experience and successful history in the surface preparation and application of coating systems to the interior and exterior surfaces of steel water storage tanks of similar or larger size as the work of this Contract. B. Proof of certification under SSPC QP Certification Program must be submitted with the Contractors bid. Required certifications are: 1. SSOC-QP 1 2. SSPC-QP 2 C. Contractor shall substantiate the qualification requirements by furnishing a written list of project references and agency contacts with the bid as required by the Notice of Inviting Bids. D. Contractor shall submit resumes of the Contractor’s Representative and key personnel to be used on the project with the bid as required by the General Provisions. E. The Contractor’s containment and ventilation plan for tank surface preparation and coating operations shall be prepared by a California certified industrial hygienist. 1.6 WORKING HOURS A. The hours of work shall be as specified in the General Provisions. B. Inspection hours made necessary by the Contractor’s operations or to respond to emergencies outside of working hours shall be scheduled and approved by the Engineer. Inspections requested by, or made necessary by action or inaction of, the Contractor on Saturdays, Sundays or holidays must be scheduled, approved by the Engineer. Contractor shall pay for such occurrences at the prevailing rate for overtime or holiday work. 1.7 QUALITY ASSURANCE A. Quality assurance procedures and practices shall be utilized to monitor all phases of surface preparation and the application and inspection of coatings throughout the duration of the project. Procedures or practices not specifically defined herein may be utilized provided they meet recognized and acceptable professional Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 SECTION 099713 STEEL WATER STORAGE TANK COATING ELM AND SKYLINE STEEL RESERVOIR COATING PROJECT CONTRACT 5024-3A 099713-8 standards and are approved by the Engineer. The Contractor shall be held strictly to the requirement of the Specifications regarding quality of materials, workmanship, and diligent execution of the Contract. Surface preparation, coatings application and final approval may be evaluated by the District in accordance with the following standards, specifications or inspection procedures: 1. The coating manufacturer’s written product data sheets and PDCA P2-04, SSPC, NACE and/or ASTM D3276 standard practices. 2. Surface preparation and condition per NACE Standard RP0178. 3. Compressed air cleanliness per ASTM D4285. 4. Ambient conditions per ASTM E337. 5. Coating preparation, mixing, application and curing. Final visual appearance per SSPC PA1. 6. Wet film thickness per ASTMD4414 and dry film thickness per ASTM D1186 or SSPC-PA2. 7. Holiday detection in accordance with NACE RP0188 and AWWA D102. B. The Contractor shall maintain copies of SDSs at the jobsite at all times. C. Materials which have been stored over 60 days or beyond the manufacturer's recommended shelf life, whichever is less, will not be allowed. Copies of all invoices showing purchase and delivery dates for all materials mentioned above will be required. D. All materials furnished and all work accomplished under the Contract shall be subject to inspection by the Engineer. E. The District shall furnish and pay for the services of a full-time coating inspector during surface preparation and coating inspection of wet and dry coatings. F. Work accomplished in the absence of prescribed inspection may be ordered removed by the Engineer and replaced under proper inspection at the cost of the Contractor, regardless of whether the work removed is found to be defective or not. Concealed work shall, upon order of the District, be uncovered to the extent required and the Contractor shall bear the entire cost of accomplishing the work and furnishing all materials necessary for the removal of the covering and its subsequent replacement as directed by the Engineer. G. All surface preparation and priming operations accomplished offsite will be subject to inspection by the Owner’s appointed quality control inspector in accordance with the General Provisions. H. The District will make, or have made, such tests or inspections as it deems necessary to assure the work complies with the requirements of the Contract. Unless otherwise specified in the General Provisions, the cost of such testing will Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 SECTION 099713 STEEL WATER STORAGE TANK COATING ELM AND SKYLINE STEEL RESERVOIR COATING PROJECT CONTRACT 5024-3A 099713-9 be borne by the District. In the event such tests reveal non-compliance with the requirements of the Contract, the Contractor shall bear the cost of such corrective measures deemed necessary by the District, as well as the cost of subsequent retesting and re-inspection. Tests or inspections by the District shall not constitute an acceptance of any portion of the work or relieve the Contractor from compliance with the terms of the Contract. 1.8 WARRANTY INSPECTION A. A Warranty inspection shall be conducted prior to the twelfth month following completion of all work and filing of the Notice of Acceptance. All key personnel present at the Pre-Construction Conference should be present at this inspection. B. The District shall establish the date for the inspection and shall notify the Contractor at least 30 days in advance. The District will drain the tank and the Contractor shall provide, at his own expense, suitable lighting, scaffolding and ventilation for the inspection. For potable water tanks, and at the District's option, the warranty inspection for interior surfaces may be accomplished by diving operations with the tank in service. C. Interior Inspection: The entire interior coating systems shall be visually inspected and electrically tested in accordance with this specification and referenced standards. All defective or damaged coating or rust spots shall be satisfactorily repaired by and at the sole expense of the Contractor. All repaired areas shall then be electrically tested, and the repair and electrical testing procedure repeated until the surface conforms with the requirements herein. Defective coating shall be any of those defined by SSPC's Visual Comparison Manual. D. Exterior Inspection: The entire exterior paint system shall be visually inspected and electrically tested in accordance with this specification and referenced standards. All defective or damaged paint or rust spots shall be satisfactorily repaired by and at the sole expense of the Contractor. All repaired areas shall then be electrically tested, and the repair and electrical testing procedure repeated until the surface conforms with the requirements herein. Defective coating shall be any of those defined by SSPC's Visual Comparison Manual. E. The District shall prepare and deliver to the Contractor an inspection report covering the warranty inspection, setting forth the number and type of failures observed, the percentage of the surface area where failure has occurred, and the names of the persons making the inspection. F. Upon delivery of the inspection report as noted herein, District and Contractor shall establish a date within 90 calendar days of delivery of the inspection report for the Contractor to complete any required remedial work. All work shall be repaired in accordance with this specification and to the satisfaction of the District. The District may proceed to have defects remedied as outlined in the General Provisions in the event of delay by the Contractor in commencing or completing such remedial work. G. Any location where coating or paint has peeled, bubbled or cracked or where rusting is evident shall constitute failure of the system and will be subject to remedial work. The Contractor shall repair all such locations by removing the Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 SECTION 099713 STEEL WATER STORAGE TANK COATING ELM AND SKYLINE STEEL RESERVOIR COATING PROJECT CONTRACT 5024-3A 099713-10 defective coating, cleaning the surface, and reapplying the specified coating system. If the area of failure exceeds 25 percent of a specific coated or painted surface, the entire applied system may be required to be removed and reapplied based on the District's sole judgment in accordance with this specification. H. Surfaces to be coated shall consist of and are defined as follows: 1. Roof interior 2. Roof support structure, including rafters, beams, girders and columns 3. Topside of roof rafter. Inaccessible area to be made accessible with roof shims. 4. Shell interior and all appurtenances, such as proposed bend fitting on inlet piping 5. Floor interior 6. Roof exterior 7. Shell exterior 8. Exterior appurtenances attached to tank and previously coated (ladder, railing, outlet piping, vent covers) 9. Attachments, accessories and appurtenances manufactured of carbon steel and that are not protected by other corrosion protection systems (galvanizing, powder coating, etc). I. Upon completion of interior warranty remedial work, Contractor shall clean, disinfect and complete two consecutive passing bacterial and VOC tests for each tank as specified herein. J. The Contractor shall bear all costs for warranty inspection and repair, and disinfection where required, and shall include such costs in the bid and no additional payment will be made by the District. 1.9 SAFETY AND HEALTH REQUIREMENTS A. The Contractor shall fully comply with California Code of Regulations pertaining to the work including, but not limited to, the following Construction Safety Orders (CSO) or General Industrial Safety Orders (GISO): 1. Illness Injury Prevention Program CSO/GISO 1508/3203 2. Confined Space Plan GISO 5156/5159 Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 SECTION 099713 STEEL WATER STORAGE TANK COATING ELM AND SKYLINE STEEL RESERVOIR COATING PROJECT CONTRACT 5024-3A 099713-11 3. Respiratory Protection CSO/GISO 1531/5144 4. Hazard Communication GISO 5194 5. Rolling Scaffolds CSO 1646 6. Employee Safety Instruction CSO 1510 7. Emergency Medical Service CSO 1512 8. Dusts, Fumes, Mists, Vapors & Gases CSO 1528 9. Fall Protection CSO 10. Hearing Conservation GISO B. The Contractor shall be responsible for the performance of all work in a safe and prudent manner, and to conform to all applicable safety requirements, regulations and guidelines of federal, state and local regulatory agencies, as well as applicable manufacturer's printed instructions, standards and technical bulletins and manuals. The following practices shall be employed by the Contractor: 1. The Contractor shall provide and require the use of personal protective equipment for the safety of all personnel and the Owner’s representative working in or about the project site. 2. The Contractor shall design ladders, scaffolding and rigging for their intended uses. Ladders and scaffolding shall be erected to facilitate inspection and be moved by the Contractor to locations requested by the District. 3. The Contractor shall provide proper ventilation, air eduction and exhausting of solvent vapors to reduce the concentration of air contaminants to a level which poses no hazard to personnel at or near the job site. Air circulation and exhausting of solvent vapors shall continue until coatings have fully cured. Forced air eduction during blast cleaning and coating operations is mandatory. Exhaust blower capacities shall be sufficient to maintain air changes within the tank interior in accordance with Cal-OSHA, coating manufacturer's recommendations and local air quality management district regulations. 4. Dehumidification equipment or other alternate ventilation systems must be approved by the Engineer. Equipment must be operated on a continuous basis during all blasting, coating and curing operations, including shifts during which no work is being accomplished. 5. Personal protective equipment shall be worn by all persons while in the vicinity of the work. During abrasive blasting operations, nozzlemen shall wear U.S. Bureau of Mines or National Institute of Occupational Safety and Health (NIOSH) approved positive pressure air-supplied helmets and all Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 SECTION 099713 STEEL WATER STORAGE TANK COATING ELM AND SKYLINE STEEL RESERVOIR COATING PROJECT CONTRACT 5024-3A 099713-12 other persons who are exposed to blasting dust shall wear respiratory protection determined necessary by the exposure assessment of the Contractor’s Certified Industrial Hygienist. District reserves the right to review exposure assessment and to make additional recommendations. Positive pressure air-fed hoods and/or masks shall be supplied by an air source currently certified to produce "Class D Breathing Air". Contractor shall maintain current documentation onsite during the work to substantiate the quality of the breathing air. 6. All hoses shall be grounded to prevent accumulation of charges of static electricity. 7. Spark-proof artificial lighting shall be provided for all work in confined spaces. Light bulbs shall be guarded to prevent breakage. Lighting fixtures and flexible cords shall comply with the requirements of NFPA 70 "National Electric Code" for the atmosphere in which they will be used. When required by the Engineer, the Contractor shall provide additional illumination and necessary supports for inspection. The level of illumination for inspection purposes shall be determined by the Engineer or shall be based on GISO requirements; whichever is more stringent. 8. The maximum allowable concentration of vapor shall be kept below the maximum safe concentration for eight-hour exposure, plus Lower Explosive Limit (L.E.L.) must be strictly maintained. All regulations related to safety of personnel and handling and disposal of such materials shall be strictly followed and the costs for such activities shall be borne by the Contractor at no additional cost to the District. 9. When handling and mixing coating materials, workmen shall wear gloves and eye shields, at a minimum. Regulations regarding handling of exposed clothing shall be strictly enforced if working with lead or other heavy metals. 10. The Contractor shall provide fire abatement devices and prohibit any flames, welding and smoking during mixing and application of materials or curing periods in accordance with the coating system manufacturer instructions or applicable regulations. 11. Whenever the occupational noise exposure exceeds the maximum allowable sound levels, the Contractor shall provide and require the use of approved ear protective devices. a. Noise suppression measures shall be practiced at all times and must meet the requirements of local ordinances for noise at the property line. Such measures shall include, but not be limited to, equipping all internal combustion engines with critical residential silencers (mufflers), shielding noise-producing equipment from nearest areas of human occupancy by location in such positions as to direct the greatest noise emissions away from such areas, and conducting operations in the most effective manner to minimize noise generation consistent with the prosecution of the Contract in Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 SECTION 099713 STEEL WATER STORAGE TANK COATING ELM AND SKYLINE STEEL RESERVOIR COATING PROJECT CONTRACT 5024-3A 099713-13 a timely and economic manner. Whenever levels are objectionable, they shall be adjusted as directed by the Engineer. 1.10 COMPLIANCE WITH ENVIRONMENTAL REGULATORY REQUIREMENTS A. The Contractor shall comply with all current federal, state, and local environmental laws and regulations, including, but not limited to the laws and regulations of the U.S. Environmental Protection Agency (USEPA), the California Air Resources Board (CARB), and the San Diego County Air Pollution Control District (APCD). B. All abrasive blasting materials, coating system materials and surface preparation and coating equipment and practices shall comply with air pollution regulations, specifically the local air quality management district or air pollution control district rules: https://www.sdapcd.org/content/sdapcd/rules.html C. The Contractor shall furnish a copy all permits obtained from any regulatory agency that apply to the work of this Contract. PART 2 - PRODUCTS 2.1 GENERAL A. All materials shall be brought to the jobsite in the original sealed containers. They shall not be opened or used until District's representative has physically inspected the packaging and contents and obtained necessary data from container labels. B. All coating, paint and disinfection materials shall be stored in enclosed structures to protect them from weather and excessive heat or cold. Coatings or paints shall be protected from freezing. Materials exceeding the storage life recommended by the manufacturer shall be rejected. Copies of invoices showing purchase and delivery dates will be required. C. Flammability, toxicity, allergenic properties, and any other characteristic requiring field precautions shall be identified and specific safety practices shall be followed as required by federal, state, local manufacturer or SDSs. Flammable materials must be stored to conform with City, County, State and Federal safety codes for flammable materials. D. Coating materials shall conform to the applicable regulations and requirements of local, State and Federal air pollution regulatory agencies. Products containing perchlorethylene (PCE), trichloroethylene (TCE), lead or chromium will not be permitted. E. The Contractor shall use products of the same manufacturer for all coats. Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 SECTION 099713 STEEL WATER STORAGE TANK COATING ELM AND SKYLINE STEEL RESERVOIR COATING PROJECT CONTRACT 5024-3A 099713-14 F. Substitutions required because of new VOC regulations shall be endorsed in writing from the materials manufacturer that these substituted materials will provide equivalent performance as those specified. G. The District may require that the Contractor provide certified laboratory data showing the results of complete spectrographic and durability tests accomplished on the proposed substitute. Tests shall be accomplished by an independent testing laboratory approved by the Engineer and all costs incurred in the testing program shall be borne by the Contractor. In any case, the Engineer shall be sole and final judge of the acceptability of any proposed substitution. Requests for substitution must be approved in writing. H. Standard products of manufacturers other than those specified will be accepted when it is proved, to the satisfaction of the Engineer, they are equal in composition, durability and usefulness for the intended purpose. Substitutions will be considered provided the following minimum conditions are met: 1. A mixture of surfactant and water for wetting of the ACP and retardation of fiber. 2. The proposed coating or paint system shall employ coatings or paints of the same generic type. 3. The proposed coating or paint system shall have a dry film thickness equal to or greater than that of the specified system. 4. The proposed coating or paint system shall employ an equal or greater number of separate coats. 5. Requests for substitution shall include full descriptive literature and application instructions and complete information on generic type, non- volatile content by volume and a list of 10 similar projects, all at least three years in service, where the products have been applied to similar exposure. I. Prior to coating any surfaces of the tank, the Contractor shall provide written certifications from the coating manufacturers stating that the coating materials, thinners, solvents, and equipment cleaning fluids do not contain PCE or TCE. The Contractor shall also certify, in writing, that no material containing PCE, TCE, lead, or chromium in any form will be used for the interior coatings or exterior paints of the tank. J. The District may require all solvents, thinners and cleaning fluids be tested for TCE and PCE prior to being used at the job site. The Contractor shall provide the District with samples of each material at no cost to the District. Unacceptable materials shall be removed from the job site. 2.2 INTERIOR COATING SYSTEM A. Top coat color shall be white. 1. Floor and Bottom 6’’ of Shell: Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 SECTION 099713 STEEL WATER STORAGE TANK COATING ELM AND SKYLINE STEEL RESERVOIR COATING PROJECT CONTRACT 5024-3A 099713-15 a. Prime Coat: MFG Zinc Primer or equal (NSF 61 certified in potable water service) at minimum Dry Film Thickness of 2.5 to 3.5 mils. b. Stripe Coat: MFG SB Epoxy or equal at Dry Film Thickness of 3 to 4 mils. c. Top Coat: MFG 100% Solids Epoxy or equal at minimum Dry Film Thickness of 30 mils. d. Minimum dry film thickness of the completed system shall be 32 mils. 2. Shell and Roof a. Prime Coat: MFG Zinc Primert or equal (NSF 61 certified in potable water service) at minimum Dry Film Thickness of 2.5 to 3.5 mils. b. Stripe Coat: MFG SB Epoxy or equal at Dry Film Thickness of 3 to 4 mils. c. Intermediate Coat: MFG SB Epoxy at Dry Film Thickness of 5 to 8 mils. d. Topcoat MFG SB Epoxy at Dry Film Thickness of 5 to 8 mils. e. Minimum dry film thickness of the completed system shall be 12.5 mils. B. Carboline Alternate: 1. Floor and Bottom 6” of Shell: a. Prime Coat: Carbozinc 859 VOC or equal (NSF 61 certified in potable water service) at minimum Dry Film Thickness of 2.5 mils. b. Top Coat: Phenoline Tank Shield at minimum Dry Film Thickness of 30 mils. c. Minimum dry film thickness of the completed system shall be 32 mils. 2. Shell and Roof: a. Prime Coat: Carbozinc 859 VOC or equal (NSF 61 certified in potable water service) at minimum Dry Film Thickness of 2.5 mils. b. First Intermediate Coat: Carboguard 891 VOC at Dry Film Thickness of 4 to 6 mils. c. Second Intermediate Coat: Carboguard 891 VOC at Dry Film Thickness of 4 to 6 mils. Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 SECTION 099713 STEEL WATER STORAGE TANK COATING ELM AND SKYLINE STEEL RESERVOIR COATING PROJECT CONTRACT 5024-3A 099713-16 d. Topcoat: Carboguard 891 VOC at Dry Film Thickness of 4 to 6 mils. e. Minimum dry film thickness of the completed system shall be 15 mils. C. Sherwin Williams Alternate: 1. Floor and Bottom 6” of Shell: a. Prime Coat: Corothane 1 GalvaPac 2K at Dry Film Thickness of 2.5 mils. b. Top Coat: SherPlate PW Epoxy at minimum Dry Film Thickness of 30 mils. c. Minimum dry film thickness of the completed system shall be 32 mils. 2. Shell and Roof: a. Prime Coat: Corothane 1 GalvaPac 2K at minimum Dry Film Thickness of 2.5 mils. b. First Intermediate Coat: Macropoxy 5500LT at Dry Film Thickness of 4 to 6 mils. c. Second Intermediate Coat: Macropoxy 5500LT at Dry Film Thickness of 4 to 6 mils. d. Topcoat: Macropoxy 5500LT at Dry Film Thickness of 4 to 6 mils. e. Minimum dry film thickness of the completed system shall be 15 mils. D. Tnemec Alternate: 1. Floor and Bottom 6” of Shell: a. Prime Coat: Series 94-H2O Hydro-Zinc at Dry Film Thickness of 2.5 to 3.5 mils. b. Stripe Coat: Series L140F Pota-Pox Plus or Series 21 Epoxoline or equal at Dry Film Thickness of 3 to 4 mils. c. Top Coat: Series 22 Epoxoline at minimum Dry Film Thickness of 30 mils. d. Minimum dry film thickness of the completed system shall be 32 mils. 2. Shell and Roof: Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 SECTION 099713 STEEL WATER STORAGE TANK COATING ELM AND SKYLINE STEEL RESERVOIR COATING PROJECT CONTRACT 5024-3A 099713-17 a. Prime Coat: Series 93-H2O or 94-H20 Hydro-Zinc at Dry Film Thickness of 2.5 to 3.5 mils. b. Stripe Coat: Series L140F Pota-Pox or equal at Dry Film Thickness of 3 to 4 mils. c. Intermediate Coat: Series L140F Pota-Pox Plus at Dry Film Thickness of 5 to 8 mils. d. Topcoat: Series L140F Pota-Pox Plus at Dry Film Thickness of 5 to 8 mils. e. Minimum dry film thickness of the completed system shall be 12.5 mils. 3. Optional Tnemec High-Build Epoxy System For Shell And Roof a. Prime Coat: Series 93-H2O or 94-H2O Hydro-Zinc at Dry Film Thickness of 2.5to 3.5 mils. b. Stripe Coat: Series 21 Epoxoline or equal at Dry Film Thickness of 3 to 4 mils. c. Topcoat: Series 21 Epoxoline at minimum Dry Film Thickness of 10 to 16 mils applied in one or two coats. d. Minimum dry film thickness of the completed system shall be 12.5 mils. E. Joint sealant shall be an NSF 61 certified approved flexible polyurethane or polysulfide product, meeting Federal Specification TT-S-230. 2.3 EXTERIOR COATING SYSTEMS A. Exterior color shall match Tnemec AH22 “Buffalo Brown”. Finish color shall be selected by the District from color chart submitted by the Contractor at least three weeks prior to the start of painting operations. B. Carboline Alternate: 1. Prime Coat: Carbozinc 859 VOC at minimum Dry Film Thickness of 2.5 mils. 2. Intermediate Coat: Carboguard 890 VOC at minimum Dry Film Thickness of 4 to 6 mils. 3. Finish Coat: Carbothane 134 MC at minimum Dry Film Thickness of 4 to 6 mils. 4. Minimum dry film thickness of the completed system shall be 12 mils. Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 SECTION 099713 STEEL WATER STORAGE TANK COATING ELM AND SKYLINE STEEL RESERVOIR COATING PROJECT CONTRACT 5024-3A 099713-18 C. Sherwin Williams Alternate: 1. Prime Coat: Corothane 1 GalvaPac 2K at minimum Dry Film Thickness of 2.5 mils. 2. Intermediate Coat: Macropoxy 646-100 at minimum Dry Film Thickness of 5 to 6 mils. 3. Finish Coat: Sher-Loxane 800 Polysiloxane at minimum Dry Film Thickness of 4 to 6 mils. 4. Minimum dry film thickness of the completed system shall be 12 mils. D. Tnemec Alternate: 1. Prime Coat: Series 93-H2O or 94-H2O Hydro-Zinc at Dry Film Thickness of 2.5 to 3.5 mils. 2. Stripe Coat: Series L140F Pota-Pox or Series 21 Epoxoline or equal at Dry Film Thickness of 3 to 4 mils. 3. Intermediate Coat: SeriesL140F Pota-Pox or V69F Epoxoline or Series 21 Epoxoline at Dry Film Thickness of 4 to 6 mils. 4. Finish Coat: 1095 Endura-Shield at Dry Film Thickness of 3 to 5 mils. 5. Minimum dry film thickness of the completed system shall be 12 mils. E. Exterior joint sealant shall be a flexible polyurethane or polysulfide product, similar or equal to Federal Specification TT-S-00230C, Type II, Class A (non-sag), Sikaflex 1A, Vulkem 921, Sonolastic NP1 or approved equal. Sealant color shall be approved by the District. 2.4 DISINFECTION MATERIALS A. Disinfection materials shall conform to all requirements of AWWA Standard C652, latest revision. B. Cleaner for pre-disinfection cleaning of interior surfaces shall be Grease Away or approved equal. 2.5 CONTAINMENT AND VENTILATION SYSTEMS A. The Contractor shall provide containment and ventilation systems which allow for the efficient containment of abrasive blast media, dust, paint and debris that will be generated during surface preparation and coating operations and comply with local air pollution control and federal health regulations. B. The 24-hour Respirable Particulate Matter (PM-10) shall not exceed the limits prescribed in California (50 ȝg/m3) or federal standards (150 ȝg/m3). The 24-hour standard is attained when the expected number of days per calendar year with a Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 SECTION 099713 STEEL WATER STORAGE TANK COATING ELM AND SKYLINE STEEL RESERVOIR COATING PROJECT CONTRACT 5024-3A 099713-19 24-hour average concentration above the specified limit is equal to or less than one. C. For the California standard, the measurement method shall be Gravimetric or Beta Attenuation or any equivalent measurement method which can be shown to the satisfaction of the Air Resources Board to give equivalent results at or near the level of the air quality standard (CCR Title 17, Section 70200). For the federal standard, the measurement method shall be Inertial Separation and Gravimetric Analysis as described by the U.S. EPA or an equivalent method of measurement with a consistent relationship to the reference method and approved by the U.S. EPA. The Contractor shall conduct ambient air monitoring as described in SSPC- TU 7 and at a frequency as recommended by the Contractor’s Certified Industrial Hygienist to demonstrate compliance with air quality standards and in accordance with industry safe practices. D. The containment and ventilation systems shall conform with SSPC Guide 6 for Containment Classification 3A and as follows: 1. Containment Materials: Type A2 – Flexible 2. Containment Material Penetrability: Type B2a – Air Penetrable (tightly woven) 3. Support Structure: Type C1 – Rigid or Type C2 – Flexible Support 4. Joint Treatment: Type D2 – Partially Sealed Joints 5. Entryways: Type E3 – Entryway through Overlapping Door Tarps 6. Air Supply (Intake) Points: Type F2 – Open Air Flow 7. Input Air Flow: Type G2 – Natural Input Air Flow 8. Negative Air Pressure Inside Containment: H3 – Not Required 9. Air Movement: Type I2 – Minimum Air Movement is Not Specified 10. Exhaust Air Flow/Dust Collection: Type J1 - Air Filtration Required E. The Contractor shall provide forced exhaust air ventilation during all coating removal, debris removal, and painting operation performed on the tank. All ventilation equipment shall be explosion proof. F. The containment and ventilation requirements stated are minimum requirements. The ventilation and containment systems shall be designed by a professional engineer qualified in industrial ventilation system design. The professional engineer shall visit the project site and confirm the systems are installed in accordance with the containment and ventilation plan and are functioning as intended or required. Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 SECTION 099713 STEEL WATER STORAGE TANK COATING ELM AND SKYLINE STEEL RESERVOIR COATING PROJECT CONTRACT 5024-3A 099713-20 G. When ventilation systems are required to meet the requirements of 29 CFR 1926.57, Containment Classification 2A or 1A shall be used. When negative pressure is required or specified, it shall be verified by instruments. H. The containment system shall be designed and erected to withstand live loads in accordance with the latest California Building Code adopted by the City and in such a manner that no damaging loads are imposed by the containment system on the structure to be painted. PART 3 - EXECUTION 3.1 GENERAL A. The work shall be completed at the Elm and Skyline tanks in consecutive order with only one tank taken offline at any given time. The tank shall be returned to service prior to progressing to the next tank in the series. B. All surface preparation, coating and paint application shall conform to applicable standards of the Society for Protective Coatings, the District and the manufacturer's printed instructions. Material applied prior to approval of the surface preparation by the District shall be removed and reapplied to the satisfaction of the District at the expense of the Contractor. C. Contractor shall notify the District prior to starting field surface preparation and coating application to coordinate and schedule a pre-application meeting. Attendance shall be required of all parties directly affecting the work of this section, including the Agency’s representative, Applicator and Coating Manufacturer’s representative. The following items shall be reviewed: 1. Schedule for surface preparation and coating activities and coordination with other work. 2. Health and safety requirements 3. Environmental protection requirements 4. Field quality control 5. Protection of surfaces not scheduled to be coated 6. Surface preparation 7. Application and curing 8. Testing and repairs 9. Tank Cleaning 10. Tank Disinfection (potable water tanks only) 11. Protection of coating systems Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 SECTION 099713 STEEL WATER STORAGE TANK COATING ELM AND SKYLINE STEEL RESERVOIR COATING PROJECT CONTRACT 5024-3A 099713-21 12. Warranty inspection D. The Contractor’s representative shall be present at the work site during surface preparation, application, curing and disinfection operations. E. All work shall be accomplished by skilled craftsmen qualified to accomplish the required work in a manner comparable with the best standards of practice. F. The Contractor's equipment shall be designed for application of materials specified and shall be maintained in first class working condition. Compressors shall have suitable traps and filters to remove water and oils from the air. Blotter test shall be accomplished at each start-up period and as deemed necessary by the District. Contractor's equipment shall be subject to approval of the District. This approval does not relieve the Contractor's responsibility for the safe operation of the equipment or its performance. G. Cleanliness of compressed air supply shall be verified daily, and as deemed necessary by the District, by directing a stream of air, without abrasive, from the blast nozzle onto a white blotter or cloth for twenty seconds. If oil or water appears on the blotter or cloth, all traps and separators shall be blown down until two subsequent twenty-second tests show no further oil or water. H. Any equipment that is not in good working order or does not produce the results required by the specifications shall be removed from the site of the work upon the District’s request. I. Application of the first coat shall follow immediately after surface preparation and cleaning within an eight-hour working day. Any cleaned areas not receiving the first coat within the time specified shall be recleaned prior to application of the first coat. If dehumidification equipment is used to control the area, cleaned areas may have the first coat applied during the last shift of the week, provided the dehumidification equipment has run continuously for at least 72 hours preceding the coating application and the surface and ambient conditions meet all requirements of the specification. J. Previously coated or painted surfaces shall be protected from moisture or contaminants in the atmosphere or recleaned prior to application of subsequent coat(s). Methods of protection and recleaning shall be approved by the District. K. The work shall cease, and corrective measures immediately taken if, in the opinion of the District, cleaning and application operations are creating a localized condition detrimental to ongoing facility activities, personnel or adjacent property. All additional costs created by shutdown shall be borne by the Contractor. L. The Contractor shall take all measures necessary to confine abrasive blasting debris, dust and/or coating or paint overspray to within the boundaries of the graded tank pad. The Contractor shall take all necessary precautions to prevent off-site contamination or consequences of its operations. Complaints received by the District relating to any such potential off-site problems will be directed to the Contractor’s representative and the Contractor shall immediately halt blast cleaning or application work and implement all measures necessary to correct any Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 SECTION 099713 STEEL WATER STORAGE TANK COATING ELM AND SKYLINE STEEL RESERVOIR COATING PROJECT CONTRACT 5024-3A 099713-22 non-compliance with the specifications. All costs for the protection of off-site properties and/or correction of damage to property as a result of blast cleaning or application operations shall be borne directly by the Contractor at no additional cost to the District. M. District approval of Contractor's debris and overspray best management practices and District's presence on the project does relieve the Contractor from its responsibility to prevent migration of pollutants to off-site areas. Approval of prevention procedures will be required prior to the start of blasting or spray operations or in the event of any change in the procedures or the site conditions. 3.2 SURFACE PREPARATION – GENERAL A. The latest revision of the following surface preparation specifications of the Society for Protective Coatings shall form a part of this specification. (Note: An element of surface area is defined as any given square inch of surface). 1. Solvent Cleaning (SSPC-SP 1): Removal of oil, grease, soil and other contaminants by use of solvents, emulsions, cleaning compounds, steam cleaning or similar materials and methods, which involve a solvent or cleaning action. 2. Hand Tool Cleaning (SSPC-SP 2): Removal of loose rust, loose mill scale and other detrimental foreign matter present to degree specified by hand chipping, scraping, sanding and wire brushing. 3. Power Tool Cleaning (SSPC-SP 3): Removal of loose rust, loose mill scale and other detrimental foreign matter present to degree specified by power wire brushing, power impact tools or power sanders. 4. Commercial Blast Cleaning (SSPC-SP 6): Blast cleaning until at least two- thirds of each element of surface area is free of all visible residues. 5. Brush-off Blast Cleaning (SSPC-SP 7): Blast cleaning to remove loose rust, loose mill scale, and other detrimental foreign matter present to the degree specified. 6. Near-White Blast Cleaning (SSPC-SP 10): Blast cleaning to near-white metal cleanliness, until at least ninety-five percent of each element of surface area is free of all visible residues. 7. Power Tool Cleaning to Bare Metal (SSPC-SP 11): Power tool cleaning to produce a bare metal surface and to retain or produce a surface profile of at least 1.0 mil. 8. Low Pressure Water Cleaning (SSPC-SP 12, LPWC): Low pressure water cleaning at a maximum pressure of 5,000 PSI to remove loose rust, loose paint, and other detrimental foreign matter present. Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 SECTION 099713 STEEL WATER STORAGE TANK COATING ELM AND SKYLINE STEEL RESERVOIR COATING PROJECT CONTRACT 5024-3A 099713-23 9. Commercial Grade Powertool Cleaning (SSPC-SP 15): Powertool cleaning until at least two-thirds of each element of surface area is free of all visible residue. B. Prior to abrasive blast cleaning of the tank interior, welds in the bottom of the tank shall be vacuum tested in accordance with Section 13200. C. Tank interior coating and surfaces shall be abrasively blast cleaned to "Near-White Blast Cleaning" in conformance to SSPC's Surface Preparation Specification No. 10 (SSPC-SP 10) and a surface profile or anchor pattern of 2 to 3 mils. D. Tank exterior surfaces contain lead-based paint base coat and shall be removed and prepared per Sections 028319 and 028333. 3.3 SURFACE PREPARATION A. Examine areas and conditions under which coating systems are to be applied and notify the District of areas or conditions that are not acceptable. Do not begin surface preparation or application until unacceptable areas or conditions have been corrected. B. Slag, burrs, weld spatter, or sharp edges such as those created by flame cutting and shearing not previously removed shall be removed by chipping and grinding. All sharp edges shall be peened, ground or otherwise blunted in accordance with NACE SP 0178. It is not the intent to have the welds or "scars" ground "flush". The objective of the grinding is to eliminate sharp edges, corners, and overlaps to provide a surface for the application of a uniform thickness of coating or paint without voids, thin spots or other defects. C. All interior surfaces exhibiting bare metal, rust, scaling, or damaged coatings shall be blast cleaned in accordance with Steel Structures Painting Council Specification No. 10 "Near-White Blast Cleaning," (SSPC-SP 10). Adjacent primer shall be firmly bonded to the substrate with blast cleaned edges feathered. D. All exterior surfaces exhibiting bare metal, rust, scaling, or damaged coatings shall be blast cleaned in accordance with Steel Structures Painting Council Specification No. 10 "Near-White Blast Cleaning," (SSPC-SP 10). Adjacent primer shall be firmly bonded to the substrate with blast cleaned edges feathered. E. After abrasive blast cleaning of damaged and defective areas and feathering of edges, cleaned areas will be primed as specified herein. Spot prime repairs will not be included as part of the intermediate coat. It is the intent of this specification to ensure a three-coat system is applied to all surfaces. F. Abrasive blasting nozzles shall be equipped with "deadman" emergency shut-off nozzles. Blast nozzle pressure shall be a minimum of 95 PSI and shall be verified with an approved nozzle pressure gage at each start-up period or as directed by the Engineer. G. All blast hose connections shall be tethered and connected with external couplings. These connections shall be taped with duct tape prior to pressurizing. All taped Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 SECTION 099713 STEEL WATER STORAGE TANK COATING ELM AND SKYLINE STEEL RESERVOIR COATING PROJECT CONTRACT 5024-3A 099713-24 connections shall be visually inspected for leaks within five minutes after the start of blast cleaning operations each day and periodically throughout each day of operations. Leaking connections shall be immediately repaired. H. Field blast cleaning for all surfaces shall be by the dry method unless otherwise approved. The Contractor shall maintain dust emissions within the legal level and that level which would not create a nuisance. I. Particle size of abrasives used in blast cleaning shall be that which will produce the surface profile or anchor pattern specified herein or recommended by the manufacturer of the coating or paint system, subject to approval of the Engineer. J. Abrasive media used in blast cleaning operations shall be new, washed, graded and free of contaminants and shall not be reused unless specifically approved by the District. Abrasives shall be certified for unconfined dry blasting pursuant to the California Administrative Code, Section 92520 of Subchapter 6, Title 17, and shall appear on the current listing of approved abrasives. The Contractor shall submit invoices or load sheets confirming these requirements to the Engineer. K. Blast cleaned surfaces shall be cleaned prior to the application of coatings or paints by blowing with clean, dry air; brushing/brooming and/or vacuuming. Air hose for blowing shall be equipped with a shut-off device and shall meet GISO requirements. L. The surfaces of any non-carbon steel substrates or specialty items (i.e., galvanized, anodized, etc.) shall be properly treated and prepared prior to coating operations in accordance with the coating manufacturer's written recommendations, subject to approval of the Engineer. M. Blast cleaning from rolling scaffolds shall only be accomplished within the confines of the scaffold. Reaching beyond the limits of scaffold perimeter will be allowed only if blast nozzle is maintained in a position which will produce a profile conforming to these specifications. N. The interior surfaces of the tank inlet/outlet nozzles shall be blast cleaned per these specifications. The Contractor shall protect isolation valves at the inlet and outlet nozzles, if mounted. All exposed surfaces of the valves shall be masked prior to blast cleaning the nozzles. O. During blast cleaning operations, the inlet, outlet, overflow and drain openings shall be covered with plywood bulkheads or other approved barriers to prevent entry of debris or other foreign materials. P. All welds shall be neutralized with a suitable chemical compatible with the specified coating materials when required or recommended by the coating system manufacturer. Q. The Contractor shall keep the work area in a clean condition and shall not permit blasting debris to accumulate to constitute a nuisance or hazard to the prosecution of the work, off-site contamination or the operation of the existing facilities. The ground surface around the tank perimeter shall be protected with a layer of Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 SECTION 099713 STEEL WATER STORAGE TANK COATING ELM AND SKYLINE STEEL RESERVOIR COATING PROJECT CONTRACT 5024-3A 099713-25 polyethylene, minimum thickness of 6 mils. All debris generated and accumulated on the polyethylene shall be collected at the end of each day and disposed of in approved containers. R. Application for the necessary approvals and permits shall be made by the Contractor and coordinated with the Owner. All costs associated with the removal and disposal of debris shall be paid by the Contractor. S. Contractor shall be responsible for obtaining the certified laboratory test report and pay the costs necessary to determine if the residue generated during blasting and cleaning operations exceeds "leachable" limits for lead, arsenic, barium, cadmium, chromium, mercury, selenium and silver as determined by EPA's Toxicity Characteristic Leaching Procedure (TCLP). The laboratory must be certified by the State of California. A copy of the certified report shall be furnished to the Owner. T. Disposal of hazardous spent material is only allowed at a licensed hazardous waste disposal facility. The waste shall be transported to the facility by EPA approved licensed waste haulers. The disposal facility may require a sample of spent material for confirmation testing prior to receiving shipment. An EPA "Uniform Hazardous Waste Manifest" shall document each load of hazardous waste. The Contractor is directly and solely responsible for complying with the requirements of these hazardous waste laws in performing the work. U. Brush-Off Water Jet Blast Cleaning (SSPC-SP 12) shall be used only if approved by the Engineer and pressures shall be set to effectively remove loose, peeling/flaking coating or other surface contaminants. 1. SSPC SP12 and scarification of exterior surfaces may be required if the proximity of adjacent property dictates extraordinary precautions due to potential for property damage. Sufficient rust inhibitor, approved by the paint manufacturer, shall be added to water to prevent rusting of cleaned surfaces prior to application of coatings. At the option of the Contractor, other methods of removal may be used, provided they protect adjacent properties, produce the required surface roughness and are approved by the Engineer. V. Remove and dispose all existing caulking from shell/roof junction, roof plate lap seams, designated void areas and interface between exterior floor plate and concrete ring wall (chime). 3.4 APPLICATION – GENERAL A. Coating and paint application shall conform to the requirements of the Society for Protective Coatings Paint Application Specification SSPC-PA 1, latest revision, for "Shop, Field and Maintenance Painting," the manufacturer of the coating and paint materials printed literature and as specified herein. B. No coating shall be applied under the following conditions: 1. When the surrounding air temperature or the temperature of the surface to be coated or painted is below 55 degrees F for epoxy coatings, below 45 Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 SECTION 099713 STEEL WATER STORAGE TANK COATING ELM AND SKYLINE STEEL RESERVOIR COATING PROJECT CONTRACT 5024-3A 099713-26 degrees F for epoxy low temperature cure coatings, or above 110 degrees F for all materials. 2. On wet or damp surfaces or in rain, fog or mist. 3. When the temperature is less than 5 degrees F above the dew point. 4. When the air temperature is expected to drop below 55 degrees F for epoxy coating, below 45 degrees F for epoxy low temperature cure coatings, or less than 5 degrees F above the dew point within two hours or the manufactures specifications, which ever is longer, after application of coatings or paints. 5. When wind speeds exceed 15 miles per hour (for exterior operations only). C. If the above conditions exist or are forecast, coating application shall be delayed or postponed until conditions are favorable. The day's application shall be completed with sufficient time to permit sufficient drying time prior to damage by atmospheric conditions. D. Dew point shall be measured with a sling psychrometer in conjunction with U.S. Department of Commerce Weather Bureau Psychrometric Tables or approved dew point measurement equipment. E. Each coating or paint application shall be uniform in appearance and free of brush marks, sags, runs and no evidence of poor workmanship. Care should be exercised to avoid lapping on glass or hardware. Coatings and paints shall be sharply cut to lines. Finished surfaces shall be free from blemishes or defects as defined by SSPC's Visual Comparison Manual. F. The wet film thickness of each coat shall be measured during application. Before application of successive coats, the dry film thickness shall be measured for compliance. G. Protective coverings or drop cloths shall be used to protect floors, fixtures, equipment, prepared surfaces and applied coatings or paints. Personnel entering the tank or walking on the tank roof shall take precautions to prevent damage or contamination of coated or painted surfaces. Personnel shall wear soft-soled shoes, or shoe coverings approved by the Engineer. Care shall be exercised to prevent coating or paint from being spattered onto surfaces which are not to be coated or painted. Surfaces from which such material cannot be removed satisfactorily shall be refinished to the satisfaction of the Engineer. H. All welds and irregular surfaces shall receive a stripe coat of the specified product prior to application of each intermediate coat. Coating shall be brushed in multiple directions to ensure penetration and coverage. These areas include, but are not limited to, welds, roof lap seams, nuts, bolts, pitted areas, ends and flanges of rafters and girders, etc. Ensure dry film thicknesses of coatings and paints conform with the requirements of the product manufacturer or these specifications, whichever is greater. Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 SECTION 099713 STEEL WATER STORAGE TANK COATING ELM AND SKYLINE STEEL RESERVOIR COATING PROJECT CONTRACT 5024-3A 099713-27 I. At the conclusion of each day's blast cleaning and coating operations, a 6" wide strip of blast cleaned substrate shall remain uncoated as a marker for the following day's blast cleaning operations. J. Epoxy coated surfaces or other multi-component materials that are exposed to excessive sunlight or have exceeded the manufacturer's recommended time period for recoat shall be scarified by Brush-Off Blast Cleaning (SSPC SP 7) or methods approved by the Engineer prior to application of additional coating or paint. Scarified coating or paint shall have surface roughness as recommended by the coating manufacturer for mechanical bonding of the subsequent coat. K. All attachments, accessories, and appurtenances shall be prepared and finished in the same manner as specified for adjoining tank sections unless otherwise approved by the Engineer. L. After abrasive blast cleaning of damaged and defective areas and feathering of edges, cleaned areas will be primed as specified herein. Spot prime repairs will not be considered as a part of the intermediate coats. M. All coating components shall be mixed in exact proportions specified by the manufacturer. Care shall be exercised to ensure all material is removed from containers during mixing and metering operations. N. Coatings shall be thoroughly mixed with an approved slow-speed power mixer until all components are thoroughly combined and have a smooth consistency. Coatings shall not be applied beyond the pot-life or recoat period specified by the manufacturer. O. Thinning shall only be permitted as recommended by the coating product manufacturer and in the presence of the Inspector. Thinners shall not exceed the limits set by applicable regulatory agencies. The Contractor shall be responsible for all costs for corrective work, fines or legal action resulting from the application of any materials which have been modified or thinned to such a degree as to cause them to exceed established VOC levels. P. Application shall be by conventional or airless spray method, except as otherwise approved. Drying time between coats shall be a minimum of 24 hours or in accordance with manufacturer's instructions. Q. When two or more coats are specified, each coat shall be of contrasting color or contain an approved color additive to indicate coverage of the applied coat. A fine bristle broom and air shall be used to remove dust and other matter from each coat prior to application of subsequent coats. R. Spray nozzles shall be held perpendicular and sufficiently close to the surface being coated to avoid excessive evaporation of volatile constituents, loss of material into the air or the bridging of cracks and crevices. Reaching beyond limits of scaffold perimeter will not be permitted. All overspray shall be removed by hand or pole sanding prior to application of subsequent coat. Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 SECTION 099713 STEEL WATER STORAGE TANK COATING ELM AND SKYLINE STEEL RESERVOIR COATING PROJECT CONTRACT 5024-3A 099713-28 S. Joint sealant may be applied by caulking gun, trowel or other approved method. Sealant shall be pressed firmly into voids to achieve complete filling or sealing. T. All mixing, thinning, application and holiday detection of coatings shall be accomplished in the presence of the Inspector. U. A 7-day curing period at 70 degrees F and 50% relative humidity, or as recommended by the coating system manufacturer, shall occur before placing the epoxy coating into service. Refer to the dehumidification requirements of this specification. 3.5 APPLICATION – INTERIOR COATING SYSTEMS A. After completion of surface preparation as specified, the tank floor and the bottom 6 inches of shell shall receive the zinc/100% solids epoxy system and all other surfaces shall receive a three-coat zinc/epoxy system as specified in Part 2 of this specification. B. Shell/roof junction, roof plate lap seams, and designated void areas: 1. After completion of coating application, as specified, all void shall be filled with a joint sealant. Joint sealant may be applied by caulking gun, trowel or other approved method. Sealant shall be pressed firmly into voids to insure 100% filling/sealing. 3.6 APPLICATION – EXTERIOR PAINT SYSTEMS A. After completion of surface preparation as specified, all surfaces shall receive three complete coats of one of the coating systems specified in Part 2 of this specification. B. Additional coats shall be applied in accordance with the coating manufacturer’s recoat period. Unless otherwise approved, a minimum of 12 hours shall elapse before applying subsequent coats. C. When cement mortar is not used between the tank floor and concrete ring wall foundation, and following all paint work, apply caulking to the gap between the exterior floor plate and concrete ring wall in accordance with the manufacturer’s written recommendations, using backing rod as required to provide suitable seal. Exterior caulking shall have a smooth clean finish. D. Contractor shall provide an enclosure system which allows for the efficient containment of sand, dust, paint, and debris what will be generated during blasting and painting operations. The containment system must be a proven method used previously on similar projects with acceptable results to contain the sand, dust, paint, and debris. E. Contractor shall provide a containment system that meets the requirements of SSPC Guide 61 for Containment Classification 3 with Class A-2 walls, Class B-2a- Air Penetrable (tightly woven), Class C-2 Flexible Support, Class D-2 Partially Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 SECTION 099713 STEEL WATER STORAGE TANK COATING ELM AND SKYLINE STEEL RESERVOIR COATING PROJECT CONTRACT 5024-3A 099713-29 Sealed Joints, Class E-3 Entryway with Overlapping Door and Class F-2 Open Air Flow. F. The containment shall be designed and erected in such a manner that no damaging loads are imposed by the containment system on the tank. G. Containment requirements given are minimum requirements. The Contractor shall provide a system that will contain the paint, abrasive media, dust, and debris within the property boundary of the tank. Protect all offsite property, equipment, and vehicles. 3.7 QUALITY CONTROL A. Surface preparation will be based upon comparison with: "Pictorial Surface Preparation Standards for Painting Steel Surfaces," SSPC-VIS 1 and as described herein. Anchor profile for prepared surfaces shall be measured by using a nondestructive instrument such as a Testex Press-O-Film System in accordance with ASTM D4417. Contractor must coordinate with District inspector to examine all surface preparation work. B. Wet film thickness testing shall be performed by the Contractor at regular intervals during the coating operation. Contractor must coordinate with District inspector for examination of work and spot checks of wet film thickness. Coatings shall be repaired following such testing. C. Dry film thickness of each coat will be measured by the District’s inspector. Holiday inspection must be performed by the Contractor and witnessed by the Inspector. Contractor shall provide all inspection equipment and personnel to perform the inspections. D. Contractor shall furnish, until final acceptance of coating and painting, inspection devices in good working condition for detection of holidays and measurement of dry-film thickness of coatings. They shall also furnish National Institute of Standards and Technology/National Bureau of Standards (NIST/NBS) certified thickness calibration plates to test accuracy of thickness gauges. Gauge accuracy shall be verified, at a minimum, at the beginning and end of each work shift according to the procedures described in ASTM D7091 or more frequently if the gauge is dropped or suspected of giving erroneous readings during the work shift. Inspection devices shall be operated by, or in the presence of the Inspector with location and frequency basis determined by the District. The District may furnish its own inspection devices and render decisions based solely upon its tests. E. Film thickness testing of coatings shall be checked with a non-destructive film thickness gauge in accordance with ASTM D7091. Film thickness of flat (e.g., plate) surfaces shall be tested and the locations and frequency of the measurements shall conform with SSPC-PA 2. The acceptability of the measurements shall be evaluated for conformance with the dry film thickness requirements of this specification in accordance with SSPC-PA 2. An instrument such as Tooke Gage should be used in accordance with ASTM D4138 if a destructive test is deemed necessary. Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 SECTION 099713 STEEL WATER STORAGE TANK COATING ELM AND SKYLINE STEEL RESERVOIR COATING PROJECT CONTRACT 5024-3A 099713-30 F. Upon completion of the interior coating operations and after the required curing interval, holiday detection shall be performed on all coated surfaces below the top capacity level with an approved inspection device in accordance with NACE SP 0188. Acceptable inspection devices include but are not limited to Tinker & Rasor Models AP and AP-W holiday detectors, and SSPC, Type II units for dry film thickness gauging. Inspection devices shall be calibrated and operated in accordance with the manufacturer's instructions and SSPC-PA 2. G. The holiday detection instrument shall be set at 100 volts/mil, include a wire brush electrode, and be properly grounded. The contractor shall obtain a letter from the coating manufacturer approving this test procedure, prior to any testing. Should the manufacturer not approve the use of a high-voltage testing device, a 67.5-volt device such as a Tinker & Rasor M-1 tester shall be used. H. A thorough visual inspection shall be completed on all surfaces above the top capacity level, including nuts, bolts, ends or edges of rafters, mating surfaces, etc. with any suspected holidays verified by holiday detection, as noted. I. All areas not meeting the specified dry film thickness and all holidays, pinholes or other defects shall be marked and repaired in accordance with the manufacturer's recommendations and this specification and retested. J. Upon completion of epoxy application to shell surfaces and abrasive blast cleaning of floor plates, and before application of epoxy to the tank floor, surfaces of completed epoxy coating on lower shell which may have been subjected to damage from abrasive blast cleaning of floor areas, shall be holiday detected again and repaired as specified herein. K. The Contractor shall furnish illumination and scaffolding to permit inspection of all coated surfaces prior to acceptance of work. Contractor shall move lights and scaffolding as directed by the Inspector to enable inspection of all surfaces. 3.8 VENTILATION AND DEHUMIDIFICATION A. Ventilation systems used as an engineering control to reduce workers exposures to hazardous or toxic materials shall meet the requirements of 29 CFR 1926.57. B. For solvent-based coatings, provide ventilation during abrasive blasting and coating application and curing in confined or enclosed areas in accordance with AWWA D102-11, Section A.8.7. Forced air ventilation shall be maintained for a minimum of four (4) days following interior coating application. C. If dehumidification equipment is used, the equipment must run continuously during abrasive blasting, coating and curing. D. Dehumidification shall be used to continuously control the environment inside the tank during blast cleaning and to meet the requirements of the coating manufacturer. The system shall be meet the following requirements unless otherwise approved: E. Operation Criteria: Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 SECTION 099713 STEEL WATER STORAGE TANK COATING ELM AND SKYLINE STEEL RESERVOIR COATING PROJECT CONTRACT 5024-3A 099713-31 1. The Contractor shall design and submit for review a dehumidification and ventilation plan, which provides for a minimum cross-draft velocity of 100 feet per minute or down-draft velocity of 60 ft/min in the vicinity of the work area or as recommended by the professional engineer qualified in industrial ventilation system design considering project-specific conditions. The cross-draft velocities shall be obtained with the use of portable blower or fans. 2. The tank shall be continuously dehumidified 24 hours per day, 7 days per week during blasting, coating, between applications of coating, and until the system application is complete, until or unless approved otherwise in writing by the District. The equipment shall provide a relative humidity within the work space that does not exceed 35 percent, 24 hours per day. 3. The Contractor shall provide routine checks of the mechanical ventilation and dehumidification systems to ensure effective and continued performance. 4. The dehumidification system shall be operated and maintained at all times. Only ventilation equipment, not dehumidification equipment is required throughout the final cure period. 5. Dehumidification equipment shall also provide the necessary ventilation for the removal of solvent vapors during the coating. At all times, maintain the concentration of solvent vapors in all parts of the tank at 10-percent below the lower explosive limit (LEL). F. Sizing of the ducting, ventilation, and dehumidification equipment shall be the sole responsibility of the Contractor. The recommended minimum diameter of ducting shall be 18 inches. Size of ducting shall be larger if deemed necessary by the Contractor to comply with these specifications or any local, state, or federal safety regulations. G. Ducting shall be airtight and reinforced with spirally-wound wire to prevent collapse. Provide an appropriate connecting device between the ducting and the designated opening. H. The surfaces that are to be blasted and coated shall not be exposed to a relative humidity over 35 percent. Furthermore, these areas shall not have a surface temperature that is less than 15 degrees F above dew point at any time during cleaning and coating phases. I. Equipment: 1. The dehumidification equipment shall be a solid desiccant (not liquid, granular, or loose lithium chloride) design having a single rotary desiccant bed capable of continuous operation, fully automatic, with drip-proof automatic electrical controller. Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 SECTION 099713 STEEL WATER STORAGE TANK COATING ELM AND SKYLINE STEEL RESERVOIR COATING PROJECT CONTRACT 5024-3A 099713-32 2. The equipment shall be capable of making two complete air changes every sixty minutes unless the 100 feet per minute cross-draft velocity requirement requires a larger volume. 3. The processed air from the dehumidification unit must maintain a relative humidity of 15 percent or less. 4. During the coating phase, dehumidification units shall have auxiliary heaters capable of maintaining a constant air temperature inside the tank meeting the requirements of the product manufacturer. Air heaters are not acceptable as substitutes for dehumidification units. 5. Air chillers, heaters, or air conditioners may be used downstream of the dehumidifiers if they are approved for use by the manufacturer of the dehumidification equipment and the Engineer. J. Dehumidification equipment shall be operating continuously, 24 hours a day, seven days per week from the time abrasive blasting begins, through to completion of all lining application. Equipment shall be turned off only for regular servicing or fueling of climate control equipment or generator(s). Equipment can be turned off during periods when there is no demand for dehumidification only if automatic controls are installed that perform the following: 1. Activates and deactivates the equipment by determining the difference between the coldest surface temperature and the dew point temperature in the tank. 2. Measures and logs surface temperature, inside air temperature, inside dew point temperature and equipment run time at 1-minute intervals. Copies of this data will be delivered to the Owner’s representative. 3.9 FINAL CURING OF INTERIOR EPOXY COATINGS A. Upon completion of applied coating system, Contractor shall furnish an approved exhaust fan or blower of sufficient capacity for removal of solvent vapors during the curing process. The fan or blower shall remain in continuous operation until coating is completely cured as determined by the coating manufacturer or a minimum of four (4) days, whichever is greater. The Contractor shall operate and maintain the blower continuously during the curing period. B. If dehumidification is being used, the equipment shall remain in-place and run continuously during all curing operations. C. After completion of curing as required by the coating manufacturer, the District’s inspector shall evaluate the final cure of the applied lining in accordance with the manufacturer’s recommended procedures, and ASTM D5402 to verify adequate curing has been attained. D. If final cure has not been attained, ventilation shall be continued until applied coating passes the solvent wipe test. Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 SECTION 099713 STEEL WATER STORAGE TANK COATING ELM AND SKYLINE STEEL RESERVOIR COATING PROJECT CONTRACT 5024-3A 099713-33 E. After final cure is approved by the Engineer, the Contractor shall remove the fan or blower. 3.10 TANK CLEANING A. Cleaning shall be accomplished after completing and curing all interior recoating work and new coatings. B. The complete tank interior shall be cleaned with an approved cleaner or detergent applied via high pressure hot solution method. If deemed necessary by the District, surfaces shall be scrubbed with a brush or similar implement that will not damage the coatings to completely remove residual solvents or other contaminants. C. The surfaces shall then be rinsed with potable water. The residual water shall be thoroughly flushed from the tank. The Contractor shall obtain District approval prior to draining residual water to waste. 3.11 DISINFECTION A. The interior surfaces of potable water storage tanks shall be disinfected in accordance with AWWA C652, Section 4.2 Chlorination Method 2 as modified herein: 1. Disinfection shall be accomplished after completion and curing of all interior recoating work and new coatings. 2. Prior to disinfecting, the complete interior shall be cleaned with an approved cleaner or detergent applied via high pressure hot solution method. If deemed necessary by the District, surfaces shall be scrubbed with a fine bristle brush or similar implement which to completely remove residual solvents and other contaminants. 3. The surfaces shall then be rinsed with potable water. The residual water shall be thoroughly flushed from the tank. The Contractor shall obtain District approval prior to draining residual water to waste. 4. After completion of cleaning as noted above, all interior surfaces shall jet washed with a chlorine or chloramine solution having a concentration of 200 PPM. Chlorine or chloramine solution which accumulates on the bottom shall be dechlorinated and drained to waste after District approval. Rinsing with clean water is not required unless directed by the District. 5. Once the tank has been completely filled, the tank will be isolated from the water system and the Contractor shall take samples for bacteriological tests. Samples shall be taken immediately after filling the tank and a second sample after 24 hours. The tank is to remain out of service until the results pass California drinking water standards: absent for coliform bacteria and E. coli, and heterotrophic plate count (HPC) less than 500 colony-forming unit (CFU) per mL. The District may take additional samples for quality assurance testing Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 SECTION 099713 STEEL WATER STORAGE TANK COATING ELM AND SKYLINE STEEL RESERVOIR COATING PROJECT CONTRACT 5024-3A 099713-34 6. If the bacteriological tests fail, the Contractor will be responsible for reimbursing the District for the rejected and drained water and will be required to rechlorinate the reservoir as described above until the tests are negative. 3.12 TESTING FOR VOLATILE ORGANIC COMPOUNDS (VOC'S) A. VOC samples shall be taken by the Contractor to monitor the potential presence of VOC's that may have leached into the water. The following procedure shall be utilized: 1. After satisfactory disinfection, the water in the tank shall be retained for a period of 5 days. 2. On the sixth day, samples of water shall be taken by the Contractor in accordance with latest Health Department memoranda and delivered to an approved laboratory for testing of potential VOC's. The District may obtain additional samples for quality assurance testing. 3. The test results must show levels of leached organics to comply with levels established by the Health Department for various VOC's. Upon passing results, the tank will be placed into operating service by the District. 4. If concentrations of leached organics exceed regulatory levels, the tank shall be drained, flushed and refilled with potable water, and retested at the Contractor's expense. 3.13 CLEANUP A. Upon completion of the work, all surplus materials, containers, equipment and scaffolding shall be removed from the site. Containers with coatings, paints and thinners and all waste materials shall be disposed of offsite in accordance with applicable regulations. Spent abrasives from the blasting operation may not be dispersed on site. B. Coating or paint spots upon adjacent surfaces shall be removed and the entire jobsite cleaned. All damage to improvements or overspray on surfaces resulting from the work of this section shall be cleaned, repaired or refinished to the satisfaction of the District at no additional cost. END OF SECTION Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 $SSHQGL[$ 6LWH0DSVDQG7DQN$WWULEXWHV Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 $UF*,6:HE0DS &RS\ULJKWQHDUPDS &RQWRXUVIRRW )RRW,QGH[&RQWRXU )RRW,QWHUPHGLDWH&RQWRXU &LW\%RXQGDU\ 3DUFHO%RXQGDU\([LVWLQJ 6WUHHW1DPH 0LQRU $0 IW P $UF*,6:HE$SS%XLOGHU &RS\ULJKWQHDUPDS_ ELM TANK SITE MAP AND ATTRIBUTES ELM RESERVOIR 3151 DONNA 2919 AUSTIN TR 20 mil Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 $UF*,6:HE0DS &RS\ULJKWQHDUPDS &RQWRXUVIRRW )RRW,QGH[&RQWRXU )RRW,QWHUPHGLDWH&RQWRXU &LW\%RXQGDU\ 3DUFHO%RXQGDU\([LVWLQJ 6WUHHW1DPH 0LQRU $0 IW P $UF*,6:HE$SS%XLOGHU &RS\ULJKWQHDUPDS_ SKYLINE TANK SITE MAP AND ATTRIBUTES SKYLINE RESERVOIR 4275 SKYLINE 20 mil Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 $SSHQGL[% 7DQN3KRWRV Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 (/07$1. Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 FU R N I S H A N D IN S T A L L N E W RA I L I N G T O EX T E N D 5 - F E E T . MA T C H E X I S T I N G TY P E . FU R N I S H A N D IN S T A L L N E W RA I L I N G T O EX T E N D 5 - F E E T . MA T C H E X I S T I N G TY P E . Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 6.</,1(7$1. Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 FU R N I S H A N D IN S T A L L N E W RA I L I N G T O EX T E N D 5 - F E E T . MA T C H E X I S T I N G TY P E . FU R N I S H A N D IN S T A L L N E W RA I L I N G T O EX T E N D 5 - F E E T . MA T C H E X I S T I N G TY P E . Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 $SSHQGL[& 8WLOLW\6KXWGRZQ5HTXHVW()RUP Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 $33(1',;³/´ 8WLOLW\6KXWGRZQ&RQQHFWLRQ5HTXHVW ( Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 (3DJHRI5(9 Public Works Construction Management & Inspection ϭϲϯϱ&ĂƌĂĚĂLJǀĞ 760-602-2780 www.carlsbadca.gov 87,/,7<6+87'2:1 &211(&7,215(48(67 ( '$7(2)&211(&7,21/2&$7,212):25. &2175$&72561$0(7(/12 1$0(2)5(3$76,7(7,7/( 6,*1$785('$7( 7<3(2)&211(&7,21 6(:(5 :$7(5 5(&<&/(':(77$3 6+87'2:1 /(1*7+2)6+87'2:1 )52072 727$/+2856 6(59,&(6())(&7(' 0$7(5,$/(48,30(1772%(86(' 3/($6(5($'%(/2: 5HTXHVWPXVWLQFOXGHD '(7$,/('6.(7&+VKRZLQJSURSRVHGFRQVWUXFWLRQ 6HHRWKHUVLGHIRUGHWDLOV 6XEPLVVLRQRIWKLVUHTXHVWVKDOOEHDPLQLPXPRIWZRZHHNVSULRUWRGHVLUHGVKXWGRZQFRQQHFWLRQGDWH ,IWKHZHDWKHURUDVLWXDWLRQGHYHORSVZKHUHWKHWLPHRIVKXWGRZQLVQRWIHDVLEOHDQHZVKXWGRZQWLPH VKDOOEHUHVXEPLWWHGWRWKHGLVWULFWIRUDSSURYDO 7HPSRUDU\ZDWHUVXSSO\VKDOOEHRQO\IURPDQDSSURYHGDQGDFFHSWHG&0:'OLQH 1R&0:'YDOYHVVKDOOEHRSHUDWHGH[FHSWXQGHUGLUHFWLRQRI&0:'UHSUHVHQWDWLYH 7KHUHVKDOOEH126+87'2:16021'$<6)5,'$<6:((.(1'625+2/,'$<6 7KHFRQWUDFWRUVKDOOKDYHKLVUHSUHVHQWDWLYHOLVWHGDERYHRQWKHVLWHRIFRQVWUXFWLRQGXULQJWKHHQWLUH GXUDWLRQRIWKHVKXWGRZQDnd will have authority to act in the company’s behalf. &216758&7,210$1$*(0(17$1',163(&7,21 )$5$'$<$9( &$5/6%$'&$/,)251,$ 7(/12 &,7<,163(&725 '$7( ',675,&7$33529$/6,*1$785( '$7( PUBLIC WORKS MANAGER, UTILITY OPERATIONS Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 (3DJHRI5(9 &2175$&725,16758&7,216–3/($6(5($'%()25(68%0,77,1* 5HTXHVW VKDOO QRW EH DSSURYHG XQOHVV D'(7$,/(' 6.(7&+ ,6 $77$&+(' VKRZLQJ SURSRVHG FRQVWUXFWLRQ 6HHH[DPSOHEHORZ 8WLOLW\VKXWGRZQFRQQHFWLRQUHTXHVWVKDOOEHVXEPLWWHGWR&RQVWUXFWLRQ0DQDJHPHQW ,QVSHFWLRQVWZR ZHHNVEHIRUHDQWLFLSDWHGFRQQHFWLRQGDWH 6FKHGXOLQJ 3ULRUWRVWDUWRIZRUNWKHUHVKDOOEHD0,1,0802)7:2:((.6127,&(*,9(172 ',675,&7 &RQQHFWLRQ VKDOO QRW EH SHUPLWWHG XQOHVV%$&7(5,2/2*,&$/ 7(67 5(68/76DUH DWWDFKHG UHTXLUHGIRUDOOSRWDEOHXVHOLQHV ,IWKHZHDWKHURUDVLWXDWLRQGHYHORSVZKHUHWKHWLPHRIVKXWGRZQLVQRWIHDVLEOHDQHZVKXWGRZQWLPH VKDOOEHUHVXEPLWWHGWRWKH'LVWULFWIRUDSSURYDO 7HPSRUDU\ZDWHUVXSSO\VKDOOEHRQO\IURPDQDSSURYHGDQGDFFHSWHG&0:'OLQH 12&0:'9$/9(6VKDOOEHRSHUDWHGH[FHSWXQGHUWKHGLUHFWLRQRI&0:'5HSUHVHQWDWLYH 7KHUHVKDOOEH126+87'2:16021'$<6)5,'$<6:((.(1'625+2/,'$<6 7KHFRQWUDFWRUVKDOOKDYHKLVUHSUHVHQWDWLYH OLVWHGRQWKHIURQW RQWKHVLWHRIFRQVWUXFWLRQGXULQJWKH entire duration of the shutdown and will have authority to act in the company’s behalf. ,IWKHFRQWUDFWRUKDVSUHIHUUHGFRQQHFWLRQGDWHSOHDVHSURYLGHZLWKVXEPLWWDO 7KH&LW\UHVHUYHVWKHULJKWWRFKDQJHWKHVFKHGXOH Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 $SSHQGL[' 'HWDLO6KHHW Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 12-INCH DIA. 45-DEGREE BEND TANK INLET DETAIL EX. BALL VALVE REMOVE AND RECONNECT 2-INCH X 1-INCH NYLON HEX B TANK EXTERIOR CUT, REMOVE EXISTINGOUTLET PORT AND FIELD WELD NEW 2''x3000# FULL COUPLINGTYPE 316 SS GUARDRAIL PANEL EXTENSION 2-INCH DIA. OUTLET REPLACEMENT 1/4'' 1/4''TYP 1/4'' THICK STEEL PIPE 5024-3A RESERVIOR STEEL COATING PROJECT DETAILS TANK INTERIOR Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 $SSHQGL[( 5HVHUYRLU5HFRUG'UDZLQJV Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 $SSHQGL[) &$5%)OHHW&RPSOLDQFH&HUWLILFDWLRQ Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 &LW\$WWRUQH\$SSURYHG9HUVLRQ ',6&/2685( 68%0,77$/5(48,5(0(17 9(+,&/((0,66,21',6&/2685( &203/,$1&(5(48,5(0(17 7KLV3URMHFWLVVXEMHFWWRWKHIROORZLQJUHJXODWLRQ V E\WKH&DOLIRUQLD$LU5HVRXUFHV%RDUG,Q ELGGLQJWKLV3URMHFWLWVKDOOEHWKH%LGGHU¶VVROHUHVSRQVLELOLW\WRHYDOXDWHDQGLQFOXGHWKHFRVWRI FRPSO\LQJ ZLWK DOO HTXLSPHQW DQG YHKLFOH HPLVVLRQ UHTXLUHPHQWVXQGHU WKLV &RQWUDFW DQG DSSOLFDEOHODZLQLWV%LG $'9$1&('&/($1)/((76 9HKLFOHVZLWKD*URVV9HKLFOH:HLJKW5DWLQJ *9:5 JUHDWHUWKDQOEVDQGOLJKWGXW\ SDFNDJHGHOLYHU\YHKLFOHVRSHUDWHGLQ&DOLIRUQLDPD\EHVXEMHFWWRWKH&DOLIRUQLD$LU5HVRXUFHV %RDUG $GYDQFHG &OHDQ )OHHWV UHJXODWLRQV 6XFK YHKLFOHV PD\ WKHUHIRUH EH VXEMHFW WR UHTXLUHPHQWVWRUHGXFHHPLVVLRQVRIDLUSROOXWDQWV)RUPRUHLQIRUPDWLRQSOHDVHYLVLWWKH&$5% $GYDQFHG&OHDQ)OHHWVZHESDJHDWKWWSV ZZDUEFDJRYRXUZRUNSURJUDPVDGYDQFHGFOHDQ IOHHWV %LGGHUVXWLOL]LQJVXEFRQWUDFWRUVVKDOOSURYLGHDVLJQHGFHUWLILFDWHRIUHSRUWHGFRPSOLDQFHIRUHDFK OLVWHGVXEFRQWUDFWRULQWKHVSDFHSURYLGHGLQWKH3URSRVHG6XEFRQWUDFWRUVIRUP%LGGHUVDQGLWV VXEFRQWUDFWRUVPXVWEHUHJLVWHUHGDVFRPSOLDQWIOHHWVDWWKHWLPHRIELGVXEPLWWDO,QWKHHYHQW WKDWDELGGHURULWVVXEFRQWUDFWRUVDUHH[HPSWIURPWKLVUHJXODWLRQWKHELGGHUPXVWVXEPLWD VLJQHGVWDWHPHQWDWWHVWLQJWRWKHIDFWDQGWRWKHUHDVRQ V ZK\LWLVQRWVXEMHFWWRWKH+LJK3ULRULW\ DQG)HGHUDO)OHHWV5HJXODWLRQRI7LWOH&&56HFWLRQWKURXJKDQGWKH6WDWHDQG /RFDO*RYHUQPHQW)OHHWV5HJXODWLRQRI7LWOH&&56HFWLRQWKURXJK )DLOXUHWRFHUWLI\DVDFRPSOLDQWIOHHWRUSURYLGHDQDWWHVWDWLRQWRDQH[HPSWLRQPD\UHQGHU WKHELGQRQUHVSRQVLYH ,186(2))52$'',(6(/)8(/(')/((76 $Q\FRQWUDFWRUXWLOL]LQJRIIKLJKZD\YHKLFOHVRUHTXLSPHQWPD\EHVXEMHFWWRFRPSOLDQFHZLWKWKH ,Q8VH2II5RDG'LHVHO)XHOHG)OHHWV5HJXODWLRQ)RUPRUHLQIRUPDWLRQSOHDVHYLVLWWKH&$5% ,Q8VH 2II5RDG 'LHVHO)XHOHG )OHHWV 5HJXODWLRQ ZHESDJH DW KWWSV ZZDUEFDJRYRXU ZRUNSURJUDPVXVHURDGGLHVHOIXHOHGIOHHWVUHJXODWLRQ %LGGHUVVKDOOVXEPLWZLWKLWV%LGDYDOLG&DOLIRUQLD$LU5HVRXUFHV%RDUGFHUWLILFDWHRIUHSRUWHG FRPSOLDQFH%LGGHUVXWLOL]LQJVXEFRQWUDFWRUVVKDOOVXEPLWWKH'2256,'QXPEHUIRUHDFKOLVWHG VXEFRQWUDFWRU LQ WKH VSDFH SURYLGHG LQ WKH 3URSRVHG 6XEFRQWUDFWRUV IRUP %LGGHUV DUH UHVSRQVLEOHIRULQFOXGLQJDFHUWLILFDWHRIUHSRUWHGFRPSOLDQFHIRUHDFKLGHQWLILHGVXEFRQWUDFWRU )DLOXUHWRVXEPLWYDOLGFHUWLILFDWHVPD\UHQGHUWKHELGQRQUHVSRQVLYH *(1(5$/&203/,$1&(:,7+/$:6 &RQWUDFWRUZLOONHHSIXOO\LQIRUPHGRIIHGHUDOVWDWHDQGORFDOODZVDQGRUGLQDQFHVDQGUHJXODWLRQV ZKLFKLQDQ\PDQQHUDIIHFWWKRVHHPSOR\HGE\&RQWUDFWRURULQDQ\ZD\DIIHFWWKHSHUIRUPDQFH RIWKH6HUYLFHVE\&RQWUDFWRU&RQWUDFWRUZLOODWDOOWLPHVREVHUYHDQGFRPSO\ZLWKWKHVHODZV RUGLQDQFHVDQGUHJXODWLRQVDQGZLOOEHUHVSRQVLEOHIRUWKHFRPSOLDQFHRI&RQWUDFWRU VVHUYLFHV ZLWKDOODSSOLFDEOHODZVRUGLQDQFHVDQGUHJXODWLRQV &RQWUDFWRUZLOOEHDZDUHRIWKHUHTXLUHPHQWVRIWKH,PPLJUDWLRQ5HIRUPDQG&RQWURO$FWRI DQGZLOOFRPSO\ZLWKWKRVHUHTXLUHPHQWVLQFOXGLQJEXWQRWOLPLWHGWRYHULI\LQJWKHHOLJLELOLW\IRU HPSOR\PHQW RI DOO DJHQWV HPSOR\HHV VXEFRQWUDFWRUV DQG FRQVXOWDQWV ZKRVH VHUYLFHV DUH UHTXLUHGE\WKLV$JUHHPHQW Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 &LW\$WWRUQH\$SSURYHG9HUVLRQ &RQWUDFWRULVDZDUHRIWKHUHTXLUHPHQWVRIWKHHPLVVLRQVUHGXFWLRQUHJXODWLRQVEHLQJPDQGDWHG E\ WKH &DOLIRUQLD $LU 5HVRXUFHV %RDUG ³&$5%´ DQG WKDW LW ZLOO FRPSO\ ZLWK DOO DSSOLFDEOH UHJXODWLRQVEHIRUHFRPPHQFLQJWKHSHUIRUPDQFHRIWKHZRUNDQGPDLQWDLQFRPSOLDQFHWKURXJKRXW WKHGXUDWLRQRIWKLV$JUHHPHQW &$/,)251,$$,55(6285&(6%2$5' 7KH&DOLIRUQLD$LU5HVRXUFHV%RDUG ³&$5%´ LPSOHPHQWHGDPHQGPHQWVWRWKH,Q8VH2II5RDG 'LHVHO)XHOHG)OHHWV5HJXODWLRQV ³5HJXODWLRQ´ ZKLFKDUHHIIHFWLYHRQ-DQXDU\DQG DSSO\EURDGO\WRDOOVHOISURSHOOHGRIIURDGGLHVHOYHKLFOHVKRUVHSRZHURUJUHDWHUDQGRWKHU IRUPVRIHTXLSPHQWXVHGLQ&DOLIRUQLD$FRS\RIWKH5HJXODWLRQLVDYDLODEOHDW KWWSV ZZDUEFDJRYVLWHVGHIDXOWILOHVEDUFXUHJDFWRIIURDGGLHVHODSSDSGI %LGGHUVDUHUHTXLUHGWRFRPSO\ZLWKDOO&$5%DQG5HJXODWLRQUHTXLUHPHQWVLQFOXGLQJZLWKRXW OLPLWDWLRQDOODSSOLFDEOHVHFWLRQVRIWKH5HJXODWLRQDVFRGLILHGLQ7LWOHRIWKH&DOLIRUQLD&RGH RI5HJXODWLRQVVHFWLRQ et seq. WKURXJKRXWWKHWHUPRIWKH3URMHFW%LGGHUVPXVWSURYLGH ZLWK WKHLU %LG FRSLHV RI %LGGHU¶V DQG DOO OLVWHGVXEFRQWUDFWRUVWKHPRVWUHFHQWYDOLG &HUWLILFDWHRI5HSRUWHG&RPSOLDQFH ³&5&´ LVVXHGE\&$5%)DLOXUHWRSURYLGHYDOLG&5&V DVUHTXLUHGKHUHLQPD\UHQGHUWKH%LGQRQUHVSRQVLYH 7KH&LW\RI&DUOVEDGLVD3XEOLF:RUNV$ZDUGLQJ%RG\DVWKDWWHUPLVGHILQHGXQGHU7LWOH &DOLIRUQLD&RGHRI5HJXODWLRQVVHFWLRQ F $FFRUGLQJO\%LGGHUVPXVWVXEPLWZLWKWKHLU %LGVYDOLG&HUWLILFDWHVRI5HSRUWHG&RPSOLDQFH ³&5&´ IRUWKH%LGGHU¶VIOHHWDQGIRUWKHIOHHWV RIDQ\OLVWHGVXEFRQWUDFWRUV LQFOXGLQJDQ\DSSOLFDEOHOHDVHGHTXLSPHQWRUYHKLFOHV %LGGHUVPXVW FRPSOHWHDQGVXEPLWWKH)OHHW&RPSOLDQFH&HUWLILFDWLRQRQWKHIRUPSURYLGHG)DLOXUHWRSURYLGH D&5&IRUWKH%LGGHUDQGIRUDOOOLVWHGVXEFRQWUDFWRUVRUIDLOXUHWRFRPSOHWHWKH)OHHW&RPSOLDQFH &HUWLILFDWLRQPD\UHQGHUWKH%LGQRQUHVSRQVLYH &203/,$1&(:,7+&$/,)251,$$,55(6285&(6%2$5'5(*8/$7,216 &RQWUDFWRU VKDOO FRPSO\ DQG VKDOO HQVXUH DOO VXEFRQWUDFWRUV FRPSO\ ZLWK DOO DSSOLFDEOH UHTXLUHPHQWV RI WKH PRVW FXUUHQW YHUVLRQ RI WKH &DOLIRUQLD $LU5HVRXUFHV %RDUG ³&$5%´ UHJXODWLRQV LQFOXGLQJ ZLWKRXWOLPLWDWLRQ DOO DSSOLFDEOH WHUPV RI 7LWOH &DOLIRUQLD &RGH RI 5HJXODWLRQV'LYLVLRQ&KDSWHU DQGDOOSHQGLQJDPHQGPHQWV ³5HJXODWLRQ´ 7KURXJKRXWWKH3URMHFWDQGIRUWKUHH \HDUVWKHUHDIWHU&RQWUDFWRUVKDOOPDNHDYDLODEOHIRU LQVSHFWLRQDQGFRS\LQJDQ\DQGDOOGRFXPHQWVRULQIRUPDWLRQDVVRFLDWHGZLWK&RQWUDFWRU¶VDQG VXEFRQWUDFWRUV¶IOHHWLQFOXGLQJZLWKRXWOLPLWDWLRQ&HUWLILFDWHVRI5HSRUWHG&RPSOLDQFH ³&5&´ IXHOUHIXHOLQJUHFRUGVPDLQWHQDQFHUHFRUGVHPLVVLRQVUHFRUGVDQGDQ\RWKHULQIRUPDWLRQWKH &RQWUDFWRULVUHTXLUHGWRSURGXFHNHHSRUPDLQWDLQSXUVXDQWWRWKH5HJXODWLRQXSRQWZR FDOHQGDUGD\V¶QRWLFHIURPWKH&LW\RI&DUOVEDG &RQWUDFWRU VKDOO EH VROHO\ OLDEOH IRU DQ\ DQG DOO FRVWV DVVRFLDWHG ZLWK FRPSO\LQJ ZLWK WKH 5HJXODWLRQDVZHOODVIRUDQ\DQGDOOSHQDOWLHVILQHVGDPDJHVRUFRVWVDVVRFLDWHGZLWKDQ\DQG DOOYLRODWLRQVRUIDLOXUHVWRFRPSO\ZLWKWKH5HJXODWLRQ&RQWUDFWRUVKDOOGHIHQGLQGHPQLI\DQG KROGKDUPOHVVWKH&LW\RI&DUOVEDGLWVRIILFLDOV DSSRLQWHGDQGHOHFWHG RIILFHUVDQGHPSOR\HHV IURPDQ\FODLPVOLDELOLWLHVFRVWVSHQDOWLHVRULQWHUHVWDULVLQJRXWRIDQ\IDLOXUHRUDOOHJHGIDLOXUH WRFRPSO\ZLWKWKH5HJXODWLRQ Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5 &LW\$WWRUQH\$SSURYHG9HUVLRQ )/((7&203/,$1&(&(57,),&$7,21 %LGGHUKHUHE\DFNQRZOHGJHVWKDWWKH\KDYHUHYLHZHGWKH&$5%¶VSROLFLHVUXOHV DQGUHJXODWLRQVDQGDUHIDPLOLDUZLWKWKHUHTXLUHPHQWVRI7LWOH&DOLIRUQLD&RGH RI 5HJXODWLRQV 'LYLVLRQ &KDSWHU HIIHFWLYH RQ -DQXDU\ WKH ³5HJXODWLRQ´ %LGGHUKHUHE\FHUWLILHVVXEMHFWWRWKHSHQDOW\RISHUMXU\WKDWWKH RSWLRQ FKHFNHG EHORZ UHODWLQJ WR WKH %LGGHU¶V IOHHW DQGRU WKDW RI WKHLU VXEFRQWUDFWRU V ³)OHHW´ LVWUXHDQGFRUUHFW □7KH )OHHW LV VXEMHFW WR WKH UHTXLUHPHQWV RI WKH 5HJXODWLRQ DQGWKH DSSURSULDWH&HUWLILFDWH V RI5HSRUWHG&RPSOLDQFHKDYHEHHQDWWDFKHG KHUHWR □7KH)OHHWLVH[HPSWIURPWKH5HJXODWLRQXQGHU6HFWLRQ I DQG DVLJQHGGHVFULSWLRQRIWKHVXEMHFWYHKLFOHVDQGUHDVRQLQJIRUH[HPSWLRQ KDVEHHQDWWDFKHGKHUHWR □%LGGHU DQGRU WKHLU VXEFRQWUDFWRU LV XQDEOH WR SURFXUH 5 RU 5 UHQHZDEOHGLHVHOIXHODVGHILQHGLQWKH5HJXODWLRQSXUVXDQWWR6HFWLRQ I %LGGHUVKDOONHHSGHWDLOHGUHFRUGVGHVFULELQJWKHQRUPDO UHIXHOLQJPHWKRGVWKHLUDWWHPSWVWRSURFXUHUHQHZDEOHGLHVHOIXHODQG SURRIWKDWVKRZVWKH\ZHUHQRWDEOHWRSURFXUHUHQHZDEOHGLHVHO LH WKLUGSDUW\FRUUHVSRQGHQFHRUYHQGRUELGV □7KH)OHHWLVH[HPSWIURPWKHUHTXLUHPHQWVRIWKH5HJXODWLRQSXUVXDQWWR 6HFWLRQ L EHFDXVH WKLV 3URMHFW KDV EHHQ GHHPHG DQ ³HPHUJHQF\´DVWKDWWHUPLVGHILQHGLQ6HFWLRQ F %LGGHUVKDOO RQO\ RSHUDWH WKH H[HPSWHG YHKLFOHV LQ WKH HPHUJHQF\ VLWXDWLRQ DQG UHFRUGV RI WKH H[HPSWHG YHKLFOHV PXVW EH PDLQWDLQHG SXUVXDQW WR 6HFWLRQ L □7KH)OHHWGRHVQRWIDOOXQGHUWKH5HJXODWLRQRUDUHRWKHUZLVHH[HPSWDQG DGHWDLOHGUHDVRQLQJLVDWWDFKHGWRWKLVFHUWLILFDWLRQ 1DPHRI%LGGHU 6LJQDWXUH 1DPH 7LWOH 'DWH Docusign Envelope ID: 9891D4F7-75BF-4D1A-9201-3389A8C631B5