HomeMy WebLinkAbout2026-06-03; Planning Commission; Resolution 7578A RESOLUTION OF THE PLANNING COMMISSION OF THE CITY OF
CARLSBAD, CALIFORNIA, ADOPTING AN SB 131 FOCUSED INITIAL
STUDY AND MITIGATED NEGATIVE DECLARATION AND
MITIGATION MONITORING AND REPORTING PROGRAM TO ALLOW
FOR THE DEVELOPMENT OF A 397-UNIT, FIVE- STORY,
MULTIFAMILY RESIDENTIAL STRUCTURE WITH 548 VEHICULAR
PARKING SPACES BOTH AT GRADE AND WITHIN AN ATTACHED,
FIVE-STORY PARKING STRUCTURE ON A 9.78-ACRE SITE LOCATED
ON SALK AVENUE BETWEEN COLLEGE BLVD AND EL CAMINO REAL
(ASSESSOR PARCEL NO. 212-021-04-00), WITHIN THE FENTON
CARLSBAD CENTER SPECIFIC PLAN, IN THE NORTHWEST
QUADRANT OF THE CITY, THE RD-M ZONE, AND LOCAL FACILITIES
MANAGEMENT ZONE 5
CASE NAME: SALK AVENUE APARTMENTS
CASE NO.: SDP2025-0004 (DEV2025-0001)
WHEREAS,Hanover R.S. Limited Partnership, “Developer”, has filed a verified
application with the City of Carlsbad regarding property owned by Scripps Health, “Owner,”
described as
LOT 4 OF CARLSBAD TRACT NO. 00-20 FOX MILLER PROPERTY IN
THE CITY OF CITY OF CARLSBAD, COUNTY OF SAN DIEGO, STATE
OF CALIFORNIA, ACCORDING TO MAP THEREOF NO. 15253, FILED
IN THE OFFICE OF THE COUNTY RECORDER OF SAN DIEGO
COUNTY, JANUARY 30, 2006.
(“the Property”); and
WHEREAS, pursuant to the California Environmental Quality Act (CEQA, Public
Resources Code section 21000 et. seq.) and its implementing regulations (the State CEQA
Guidelines), Article 14 of the California Code of Regulations section 15000 et. seq., the city is the
Lead Agency for the project, as the public agency with the principal responsibility for approving
the proposed project; and
WHEREAS, the project qualifies for the statutory exemption under Public Resource
Code section 21080.66, except for the single condition of the project site containing habitat for
protected species; and
PLANNING COMMISSION RESOLUTION NO.7578_
WHEREAS, pursuant to Public Resource Code section 21080.1, a housing
development project that fails to qualify for certain CEQA exemptions due to a single
disqualifying condition may carry out a focused CEQA review limited to only those environmental
effects caused by the single disqualifying condition and waive the need for analysis of project
alternatives and growth-inducing effects; and
WHEREAS, the city prepared a single-condition Focused Initial Study/Mitigated
Negative Declaration, dated February 2026, to consider, identify and analyze the potential
environmental impacts to biological resources associated with the proposed Salk Avenue
Apartment Project (State Clearinghouse No. 2026030432, City Planning Case No. SDP 2025-0004).
The Draft IS/MND concluded that the project could result in potentially significant impacts to
Biological Resource and that all the potentially significant impacts of the project can be avoided
or reduced to insignificance with implementation of mitigation measures; and
WHEREAS, the city provided notice of the availability of the Draft IS/MND and its
intent to adopt an IS/MND to and sought comments from all interested individuals and agencies
on the Draft IS/MND as required by CEQA:
x Publishing “Notice of Intent to Adopt a Mitigated Negative Declaration” in San
Diego Union Tribune newspaper on February 25, 2026.
x Submitting a notice to the County Clerk of the County of San Diego and the
State Clearinghouse for posting.
x Providing copies of the notice to individuals and organizations that previously
submitted written requests for the notice.
x Posting of the notice and Draft IS/MND on the City of Carlsbad Planning
Department webpage; and
WHEREAS, the Draft IS/MND was issued for a minimum 30-day public review
period, which began on Feb. 25, 2026, and ended on April 10, 2026, in conformance with Public
Resources Code section 21091(b) and CEQA Guidelines sections 15072 and 15105(b). The city
received two comment letters during the 30-day public comment period, one of which was
submitted by a member of the public and one from an environmental law firm. A Response to
Comments (RTC) document was prepared and responds to all of the comment letters received
on the Draft IS/MND. An Errata Sheet (Errata) incorporates minor modifications made to the
Draft IS/MND as a result of those responses to comments. The Draft IS/MND, as revised by the
Errata section, together with the RTC, are collectively referred to herein as the Final IS/MND
(State Clearinghouse No. 2026030432) (Attachment “A”); and
WHEREAS, upon approving a project for which an IS/MND is adopted, the Lead
Agency must also adopt a Mitigation, Monitoring or Reporting Program (MMRP) pursuant to
Public Resources Code section 21081.6 and CEQA Guidelines section 15074(d); and
WHEREAS, the city duly noticed a public hearing of the Salk Avenue Apartments
Project on June 3, 2026, to consider adoption of the Final IS/MND and MMRP, and the
project. Evidence was submitted to and considered by the Planning Commission, including,
without limitation:
x Written information including all application materials and other written and
graphical information posted on the project website.
x Oral testimony from city staff, interested parties, and the public.
x dŚĞථPlanning CommissionථƐƚĂĨĨ report, dated June 3, 2026, which along with
its attachments, is incorporated herein by this reference as though fully set
forth herein.
x Additional information submitted during the public hearing; and
WHEREAS, CEQA Guidelines section 15074(b) states that prior to approving a
project, the Lead Agency must consider the proposed IS/MND together with any comments
ƌĞĐĞŝǀĞĚĚƵƌŝŶŐƚŚĞƉƵďůŝĐƌĞǀŝĞǁƉƌŽĐĞƐƐ͖ĂŶĚථ
WHEREAS, the Record of Proceedings upon which the Planning Commission bases
its decision includes, but is not limited to: (1) the Final IS/MND and the appendices and technical
reports cited in and/or relied upon in preparing the Final IS/MND and MMRP; (2) the staff reports,
city files and records and other documents, prepared for and/or submitted to the city relating to
the Final IS/MND, MMRP, and the project itself; (3) the evidence, facts, findings and other
determinations set forth in herein; (4) the General Plan and the Carlsbad Municipal Code; (5) all
designs, plans, studies, data and correspondence submitted to the city in connection with the
Final IS/MND, the MMRP, and the project itself; (6) all documentary and oral evidence received
at public workshops, meetings, or hearings or submitted to the city during the comment period
relating to the Final IS/MND and MMRP and/or elsewhere during the course of the review of the
project itself; (7) all other matters of common knowledge to the to the city, including, but not
limited to, city, state, and federal laws, policies, rules, regulations, reports, records and
projections related to development within the city and its surrounding areas.
NOW, THEREFORE, /dZ^K>sďLJƚŚĞථPlanning CommissionථŽĨƚŚĞŝƚLJŽĨ
Carlsbad as follows:
1. ZĞĐŽƌĚĂŶĚĂƐŝƐĨŽƌĐƚŝŽŶ͘ථdŚĞථPlanning CommissionථŚĂƐĐŽŶƐŝĚĞƌĞĚƚŚĞĨƵůů
ƌĞĐŽƌĚďĞĨŽƌĞŝƚ͕ǁŚŝĐŚŝŶĐůƵĚĞƐƚŚĞZĞĐŽƌĚŽĨWƌŽĐĞĞĚŝŶŐƐ͘ථ&ƵƌƚŚĞƌŵŽƌĞ͕ƚŚĞ
recitals set forth above are found to be true and correct and material to this
resolution; and are incorporated herein by reference.
2. The Draft IS/MND prepared for the project identifies potentially significant effects
on the environment, but (A) revisions in the project plans or proposals made by,
or agreed to by, the Applicant before the proposed IS/MND were released for
public review would avoid the effects or mitigate the effects to a point where
clearly no significant effect on the environment would occur, and (B), there is no
substantial evidence, in light of the whole record before the lead agency, that the
project as reviewed may have a significant effect on the environment.
3. Revisions were made to clarify information presented in the Draft IS/MND, and
only minor technical changes or additions have been made. These changes and
additions to the Draft IS/MND do not raise new important issues related to
significant effects on the environment. The modifications made to the Draft
IS/MND in the RTC and Errata simply provide minor clarifications and do not
amount to substantial revisions requiring recirculation of the IS/MND pursuant to
Section 15073.5 of CEQA Guidelines.
4. A Final IS/MND has been prepared in compliance with all requirements contained
in CEQA, CEQA Guidelines, and Carlsbad Municipal Code.
5. In determining whether the proposed project has a significant effect on the
environment, the Planning Commission is able to base its decision on substantial
evidence and has complied with Public Resources Code section 21082.2 and
CEQA Guidelines section 15091(b). Mitigation measures were developed to
reduce potential impacts to Biological Resources. The project Applicant has
agreed to implement all mitigation measures identified in the Final IS/MND in
order to reduce all potentially significant environmental impacts to a less-than-
significant level, in accordance with the MMRP (Attachment “B”). Mitigation
measures incorporated as part of the project’s conditions of approval reduce
impacts to a level less than significant, therefore an IS/MND is appropriate for
adoption. The Planning Commission hereby finds that after considering the
public comments received and the evidence and testimony before it, that the
Final IS/MND reflects the independent judgement of the city as the Lead Agency.
The IS/MND, inclusive of the RTC and Errata, has been prepared in accordance
and full compliance with CEQA and CEQA Guidelines, has been made available
and circulated for review and comment by interested members of the public and
relevant agencies as required by law, and has been presented to, reviewed and
considered by this Planning Commission prior to the decision on the project.
Therefore, the Planning Commission does hereby find that on the basis of the
whole record before it, that there is no substantial evidence that the project, as
revised and conditioned, will have a significant effect on the environment. The
Planning Commission adopts the Final IS/MND (Attachment “A”) and MMRP
(Attachment “B”), as the valid environmental review for this project. The
Planning Commission further finds that the Record of Proceedings has been
completed in compliance with CEQA and the State CEQA Guidelines, and that the
findings related to the Final IS/MND, taken together, reflect the independent
judgment of the Planning Commission.
6. The custodian of the documents and other materials which constitute the record
of proceedings upon which this decision is based is the Office of the City Clerk of
the City of Carlsbad, 1200 Village Drive, Carlsbad, CA 92008.
BE IT FURTHER RESOLVED that the Planning Commission directs the Director of
Community Development, or their designee, to file the notice of determination required by
Public Resources Code section 21152(a) within five days after project approval.
NOTICE TO APPLICANT
An appeal of this decision to the City Council must be filed with the City Clerk at 1200 Carlsbad
Village Drive, Carlsbad, California, 92008, within ten (10) calendar days of the date of the Planning
Commission’s decision. Pursuant to Carlsbad Municipal Code Chapter 21.54, section 21.54.150,
the appeal must be in writing and state the reason(s) for the appeal. The City Council must make
a determination on the appeal prior to any judicial review.
PASSED, APPROVED, AND ADOPTED at a regular meeting of the Planning
Commission of the City of Carlsbad, California, held on June 3, 2026, by the following vote, to wit:
AYES: Hubinger, Lafferty, Fitzgerald, Foster, Meenes.
NAYES: None.
ABSENT: Burrows, Merz.
ABSTAIN: None.
ROY MEENES, Chair
Carlsbad Planning Commission
ATTEST:
______________________________
ERIC LARDY, Assistant Director of
Community Development
Salk Avenue Apartments Project
AB 130/SB 131 – Final Focused Initial Study/Mitigated
Negative Declaration
SCH No. 2026030432
May2026
Lead Agency:Prepared by:
City of Carlsbad
Community Development Department
1635 Faraday Avenue
Carlsbad, CA 92008
Michael Baker International
5050 Avenida Encinas, Suite 260
Carlsbad, CA 92008
JN 205484
$WWDFKPHQW$
Final Focused Initial Study/Mitigated Negative Declaration
Salk Avenue Apartments Project Page i
TTTaaaaabbbbbllllleeeee ooooofffff
1.0 Introduction.......................................................................................................................1-1
1.1 AB 130 and SB 131 Applicability .................................................................................1-1
1.2 Format of this Focused IS/MND ..................................................................................1-2
2.0 Project Information...........................................................................................................2-1
3.0 Determination....................................................................................................................3-1
4.0 Environmental Impact Analysis ......................................................................................4-1
5.0 List of Preparers ...............................................................................................................5-1
6.0 References ........................................................................................................................6-1
LLLiiiisssssttttt
Figure 1. Regional Vicinity Map...............................................................................................2-5
Figure 2. Project Vicinity..........................................................................................................2-6
Figure 3. Conceptual Site Plan................................................................................................2-7
Figure 4a. Biological Resources/Impacts ................................................................................4-10
Figure 4b. Biological Resources/Impacts - Off-Site Sewer Line..............................................4-11
Figure 5. Plans and Policies ..................................................................................................4-12
AAAAAppppppppppeeeeennnnndddddiiiiccccceeeeesssss
Appendix A Assembly Bill 130 Statutory Exemption Checklist
Appendix B Senate Bill 131 Exclusions of Certain Types of Housing Development
Projects Checklist
Appendix C Biological Resources Technical Letter Report
Final Focused Initial Study/Mitigated Negative Declaration
Salk Avenue Apartments Project Page ii
List of Acronyms and Abbreviations
AB California Assembly Bill
CDFW California Department of Fish and Wildlife
CEQA California Environmental Quality Act
FCCSP Fenton Carlsbad Center Specific Plan
HMP Habitat Management Plan
IS Initial Study
MM Mitigation Measure
MND Mitigated Negative Declaration
ND Negative Declaration
PRC Public Resources Code
SB California Senate Bill
USFWS United States Fish and Wildlife Service
Final Focused Initial Study/Mitigated Negative Declaration
Salk Avenue Apartments Project Page 1-1
1.0 INTRODUCTION
The City of Carlsbad (City) has prepared this single-condition Focused Initial Study/Mitigated
Negative Declaration (Focused IS/MND) to address the potential environmental impacts
associated with the proposed Salk Avenue Apartments Project (project). This single-condition
Focused IS/MND is prepared in accordance with the California Environmental Quality Act (CEQA)
(California Public Resources Code [PRC] Section 21000, et seq., as amended), its implementing
guidelines (California Code of Regulations, Title 14, Section 15000, et seq., 2026), and the CEQA
provisions in California Assembly Bill (AB) 130 and California Senate Bill (SB) 131 (codified in
PRC Sections 21080.66 and 21080.1).
1.1 AB 130 and SB 131 Applicability
AB 130
AB 130 (codified in PRC Section 21080.66) establishes a statutory exemption from CEQA for
qualifying housing development projects that meet certain criteria and requirements. An AB 130
Statutory Exemption Checklist was prepared for the proposed project (refer to Appendix A). Based
on the checklist, the project would have qualified for the statutory exemption established by AB
130, except for the single condition of the project site containing habitat for protected species.
Specifically, the northwestern portion of the project site contains habitat suitable for protected
species, including coastal California gnatcatcher (Polioptila californica californica, federally
threatened, state species of concern), Crotch’s bumble bee (CBB; Bombus crotchii; state
candidate endangered), and thread-leaved brodiaea (Brodiaea filifolia; federally threatened, state
endangered, California Rare Plant Rank 1B.1).
SB 131
SB 131 (codified in PRC Section 21080.1) applies to housing development projects that fail to
qualify for certain CEQA exemptions due to a single disqualifying condition. In such “near-miss”
instances, SB 131 limits CEQA review to those environmental effects caused solely by that single
condition and waives the need for analysis of project alternatives and growth-inducing effects.
However, these “near miss” provisions do not apply to projects with multiple disqualifying
conditions, or to projects involving distribution centers, oil and gas infrastructure or on protected
land, etc. Refer to Appendix B, SB 131 Exclusions of Certain Types of Housing Development
Projects, for a complete analysis of the project’s eligibility for the SB 131 housing development
project statutory exemption. As shown in Appendix B, none of the SB 131 exclusions apply to the
project.
The Combined Effect of AB 130 and SB 131
The “near-miss” rule introduced by AB 130 and SB 131 allows for streamlined review of residential
projects that meet all but one condition for a CEQA exemption. Any CEQA review for the proposed
project should focus only on the environmental impacts related to the missed criterion. In this
instant, the “near miss” provision is where the proposed project meets all aspects of the new infill
exemption (AB 130), except that the project would impact habitat for protected species. In such
case, any CEQA review would focus only on the environmental impacts related to potential
biological impacts (SB 131).
Final Focused Initial Study/Mitigated Negative Declaration
Salk Avenue Apartments Project Page 1-2
1.2 Format of this Focused IS/MND
This single-condition Focused IS/MND is organized in the following manner:
x Section 1.0, Introduction, provides an introduction and overview of this single-condition
Focused IS/MND, including the content and format, as well as the applicability of AB 130
and SB 131 to the proposed project.
x Section 2.0, Project Information, provides a detailed description of the proposed project,
its location, surrounding land uses and setting, and required discretionary actions.
x Section 3.0, Environmental Impact Analysis, contains an analysis of the single
condition of AB 130 that was not met by the proposed project—habitat for protected
species (i.e., biological resources).
x Section 4.0, List of Preparers, lists the persons, firm, and lead agency preparing this
single-condition Focused IS/MND.
x Section 5.0, References, lists the source material for the information presented in this
single-condition Focused IS/MND.
Final Focused Initial Study/Mitigated Negative Declaration
Salk Avenue Apartments Project Page 2-1
2.0 PROJECT INFORMATION
1. Project Title:Salk Avenue Apartments
2. Lead Agency Name and Address:City of Carlsbad
Community Development Department
1635 Faraday Avenue
Carlsbad, California 92008
3. Contact Person and Phone Number:Kyle Van Leeuwen, Senior Planner
442-339-2611
4. Project Sponsor’s Name and Address:Hanover R.S. Limited Partnership
11611 San Vicente Boulevard, Suite 740
Los Angeles, California 90049
5. Project Location:The approximately 9.8-acre project site is
located on vacant, undeveloped land
south of Salk Avenue, west of El Camino
Real, east of College Boulevard, and
north of Faraday Avenue in the City of
Carlsbad, California (Assessor’s Parcel
Number 212-021-04-00). Refer to Figure
1, Regional Vicinity Map, and Figure 2,
Project Vicinity.
6. General Plan Designation:The project site is designated as
Residential, 23-30 Dwelling Units Per
Acre (du/ac) (R-30) and is located in the
Fenton Carlsbad Center Specific Plan
(FCCSP) under the City of Carlsbad
General Plan.
7. Zoning:The project site has a zoning designation
of Residential Density-Multiple (RD-M).
8. Description of Project:
The project proposes a multi-family residential development on an approximately 9.8-acre
vacant site located on Salk Avenue, east of College Boulevard and west of El Camino
Real within the FCCSP area of the City (Assessor’s Parcel Number 212-021-04-00). The
site currently consists of a vacant graded pad.
The project proposes 397 multi-family residential dwelling units (Figure 3, Conceptual
Site Plan). The project site has a General Plan land use designation of Residential (R-
30), which allows between 23 and 30 du/ac. The R-30 land use designation would allow
up to 294 units on the project site (i.e., 294 units is the base density). However, the project
qualifies for a 35 percent density bonus, pursuant to California Government Code Section
Final Focused Initial Study/Mitigated Negative Declaration
Salk Avenue Apartments Project Page 2-2
65915(f)(2) and Carlsbad Municipal Code (CMC) Chapter 21.86, because 59 units (or 20
percent of the base density) of the total dwelling units would be restricted to low-income
households. As such, a density bonus of 103 units was applied to the base density of 294
units, for a total of 397 dwelling units proposed by the project. This equates to a proposed
on-site density of 40.5 du/ac.
The breakdown of the proposed 397 residential apartment units is as follows:
Unit Types Number of Unit Types Average Square Footage
Studio 4 643
1-Bedroom 253 744
2-Bedroom 112 1,110
3-Bedroom 28 1,371
Total 397 --
The proposed residential complex would be Type III-A construction (i.e., exterior walls
would be built with non-combustible materials) and would include one 5-story building with
a maximum building height of 59 feet, with allowed architectural projections up to 74 feet,
7 inches. The gross building area would total approximately 416,152 square feet. The
residential complex would include approximately 27,000 square feet of outdoor open
space areas, including courtyards, private balconies, and residential amenities such as a
swimming pool and pool deck courtyard, and interior courtyards.
Interior amenities would include fitness facilities, co-working space, and a media room.
Landscaping would occur throughout the development and would include drought-
resistant and ignition-resistant trees, shrubs, vines, plants, and groundcover. Additionally,
retaining walls ranging from approximately 4 to 9 feet in height would be erected along
the perimeter of the proposed development.
Parking
A total of 541 vehicular parking spaces is proposed both at-grade and within a five-level
aboveground parking structure with rooftop parking. The parking structure footprint would
total approximately 107,300 square feet. The parking structure would include 70 electric
vehicle charging stations. An additional five spaces are proposed as drop-off, delivery, and
van accessible spaces near the main entrance of the residential complex.
Utilities
The project would include off-site tie-in connections to existing water (including dedicated
pipelines extension for potable, recycled, and fire), sewer, storm water, electricity, and
natural gas in Salk Avenue adjacent to the project site. Once utility tie-ins are completed,
Salk Avenue would be repaved.
Final Focused Initial Study/Mitigated Negative Declaration
Salk Avenue Apartments Project Page 2-3
Other off-site improvements would include replacement of approximately 875 linear feet
of sewer pipeline beneath College Boulevard between El Camino Real and Sunny Creek
Road.
Fire Safety
In addition to the proposed Type III-A construction, the project would include drought-
resistant and ignition-resistant landscaping. A 60-foot-wide fuel modification area would
encompass the proposed residential building in accordance with the City’s Landscape
Manual (2016). Fuel modification zones would be maintained during routine landscape
maintenance. The City Fire Department has reviewed and preliminarily approved the
proposed fuel modification zones for the project. Further, the proposed project driveway
and internal access road width would meet the requirements for fire apparatus. As such,
it is anticipated that the project would meet fire safety requirements pursuant to the City
Fire Department and the CMC. A final fire protection plan is required to be approved under
the California Fire Code before building permit issuance. The plan's final review and
approval by the City Fire Department would ensure that the proposed fire protection and
suppression systems meet the necessary safety and performance standards as required
by applicable law and code.
Construction
The main phases of construction would include site preparation and grading, foundations
and building construction, and finishing. The total construction duration is anticipated to
be 22 months. Cut and fill (site grading) would be balanced on the site (23,500 cubic yards
of cut and fill, resulting in no soil export or import).
9. Surrounding Land Uses and Setting:
As shown on Figure 2, Project Vicinity, light industrial buildings are adjacent to the
project site to the east and south, and a private driving range and golf facility are adjacent
to the west. A Scripps medical office building borders the project site to the north, opposite
Salk Avenue. The site is within the FCCSP,which was developed to address the need for
a full mix of office and medical facilities in the City, to serve both residents and the daily
workforce, as well as providing housing close to jobs, including housing affordable to
lower-income households.
Surrounding land uses near the proposed off-site sewer line within College Boulevard
include a residential community immediately east of College Boulevard and a planned
residential community will be constructed in a currently vacant, graded area immediately
west of College Boulevard.
Final Focused Initial Study/Mitigated Negative Declaration
Salk Avenue Apartments Project Page 2-4
10
.
Agency Approvals:
Agency Discretionary Action
Lead Agency
City of Carlsbad
Adoption of the Focused IS/MND and approval of the
project
Issuance of a Site Development Permit
Trustee Agency
California Department of
Fish and Wildlife (CDFW)
Consultation and potential issuance of an Incidental Take
Permit for species protected by the state Endangered
Species Act if Crotch’s bumble bee occur on-site
Responsible Agency
San Diego Regional Water
Quality Control Board
Issuance of National Pollutant Discharge Elimination
System Permit Construction General Permit and approval
of Stormwater Pollution Prevention Plan
11. Have California Native American tribes traditionally and culturally affiliated with the
project requested consultation pursuant to Public Resources Code section
21080.3.1? If so, is there a plan for consultation that includes, for example, the
determination of significance of impacts to tribal cultural resources, procedures
regarding confidentiality, etc.?
The City mailed US Postal Service-certified mail and emailed letters to the Desert Cahuilla
Indians, Mesa Grande Band of Diegueño Mission Indians, Rincon Band of Luiseño
Indians, and San Luis Rey Band of Mission Indians on January 5, 2026, to initiate the
AB 52 notification process, in accordance with AB 52 tribal notification requirements.
Consultation was requested by the Rincon Band of Luiseño Indians. The City coordinated
with the tribe, and an agreement was made that the tribe will provide tribal cultural
monitoring during ground-disturbing construction activities associated with the project (as
part of the Conditions of Approval for the project). As such, AB 52 consultation has
concluded.
3URMHFW6LWH
3URMHFW/RFDWLRQ
l
6RXUFH(VUL$UF*,62QOLQH86*66DQ'LHJR&RXQW\
5HJLRQDO9LFLQLW\0DS
)LJXUH
)2&86(',601'
6$/.$9(18($3$570(176352-(&7
-
1
?
?
6
D
Q
W
F
D
K
X
E
?
V
D
Q
G
F
D
I
V
?
+
U
R
R
W
?
3
'
$
7
$
?
B
+
D
Q
R
Y
H
U
&
D
U
O
V
E
D
G
?
*
,
6
?
$
3
5
;
?
+
D
Q
R
Y
H
U
6
D
O
N
$
Y
H
1
5
?
+
D
Q
RY
H
U
6
D
O
N
$
Y
H
1
5
D
S
U
[
0LOHV
l
)HHW
3URMHFW6LWH
/LPLWVRI'LVWXUEDQFH
&ROOHJH%OYG6HZHU5HSODFHPHQW/LPLWVRI'LVWXUEDQFH
)2&86(',601'
6$/.$9(18($3$570(176352-(&7
6RXUFH(VUL$UF*,62QOLQH6DQ'LHJR&RXQW\1HDUPDS,PDJHU\
&ROOHJH%OYG
)DUDGD\
$
Y
H
(O&DPLQR5HDO
/HJHQG
-
1
?
?
6
D
Q
W
F
D
K
X
E
?
V
D
Q
G
F
D
I
V
?
+
U
R
R
W
?
3
'
$
7
$
?
B
+
D
Q
R
Y
H
U
&
D
U
O
V
E
D
G
?
*
,
6
?
$
3
5
;
?
+
D
Q
R
Y
H
U
6
D
O
N
$
Y
H
1
5
?
+
D
Q
RY
H
U
6
D
O
N
$
Y
H
1
5
D
S
U
[
)LJXUH
6DON$YH
3URMHFW9LFLQLW\
3ULHV
W
O
\
'
U
5HVLGHQWLDO&RPPXQLW\
8QGHU&RQVWUXFWLRQ
5HVLGHQWLDO
&RPPXQLW\
&RPPHUFLDO7D\ORU0DGH
*ROI)DFLOLW\
&RPPHUFLDO
&RPPHUFLDO
&ROOHJH%OYG
6HZHU5HSODFHPHQW/RFDWLRQ
l
6RXUFH)XVFRH(QJLQHHULQJ1RYHPEHU
&RQFHSWXDO6LWH3ODQ
)LJXUH
)2&86(',601'
6$/.$9(18($3$570(176352-(&7
-
1
?
?
6
D
Q
W
F
D
K
X
E
?
V
D
Q
G
F
D
I
V
?
+
U
R
R
W
?
3
'
$
7
$
?
B
+
D
Q
R
Y
H
U
&
D
U
O
V
E
D
G
?
*
,
6
?
$
3
5
;
?
+
D
Q
R
Y
H
U
6
D
O
N
$
Y
H
1
5
?
+
D
Q
RY
H
U
6
D
O
N
$
Y
H
1
5
D
S
U
[
127726&$/(
Final Focused Initial Study/Mitigated Negative Declaration
Salk Avenue Apartments Project Page 3-1
3.0 DETERMINATION
On the basis of this initial evaluation:
܆ I find that the proposed project COULD NOT have a significant effect on the environment,
and a NEGATIVE DECLARATION will be prepared.
܈ I find that although the proposed project could have a significant effect on the environment,
there will not be a significant effect in this case because revisions in the project have been
made by or agreed to by the project proponent. A MITIGATED NEGATIVE DECLARATION
will be prepared.
܆ I find that the proposed project MAY have a significant effect on the environment, and an
ENVIRONMENTAL IMPACT REPORT is required.
܆ I find that the proposed project MAY have a "potentially significant impact" or "potentially
significant unless mitigated" impact on the environment, but at least one effect 1) has been
adequately analyzed in an earlier document pursuant to applicable legal standards, and 2)
has been addressed by mitigation measures based on the earlier analysis as described on
attached sheets. An ENVIRONMENTAL IMPACT REPORT is required, but it must analyze
only the effects that remain to be addressed.
܆ I find that although the proposed project could have a significant effect on the environment,
because all potentially significant effects (a) have been analyzed adequately in an earlier
EIR or NEGATIVE DECLARATION pursuant to applicable standards, and (b) have been
avoided or mitigated pursuant to that earlier EIR or NEGATIVE DECLARATION, including
revisions or mitigation measures that are imposed upon the proposed project, nothing
further is required.
Signature Date
Final Focused Initial Study/Mitigated Negative Declaration
Salk Avenue Apartments Project Page 4-1
4.0 ENVIRONMENTAL IMPACT ANALYSIS
The environmental evaluation below is limited to the Biological Resources thresholds from
Appendix G of the CEQA Guidelines, as habitat on-site is the “near-miss” single condition that
was identified in evaluating AB 130 / SB 131 statutory exemption applicability (see Appendix A).
For the evaluation of potential impacts to biological resources, the questions in the Initial Study
(IS) Checklist are stated and a determination and explanation are provided. The analysis
considers short-term (construction) and long-term (operation), direct and indirect impacts of the
project.
To each question, there are four possible responses:
x No Impact. The project would not have any measurable environmental impact on the
environment.
x Less Than Significant Impact. The project would have the potential for impacting the
environment, although this impact would be below established thresholds that are
considered to be significant.
x Less Than Significant Impact with Mitigation Incorporated. The project would have
the potential to generate impacts which may be considered a significant effect on the
environment, although measures or changes to the development’s physical or operational
characteristics can reduce these impacts to levels that are less than significant.
x Potentially Significant Impact. The project would have impacts which are considered
significant, and additional analysis is required to identify measures that could reduce these
impacts to less than significant levels.
Final Focused Initial Study/Mitigated Negative Declaration
Salk Avenue Apartments Project Page 4-2
EEEvvvvvaaaaallllluuuuuaaaaatttttiiiiiooooonnnnn ooooofffff
Potentially Significant Impact
Less Than Significant Impact with Mitigation Incorporated
Less Than Significant Impact No Impact
a) Have a substantial adverse effect, either directly or
through habitat modifications, on any species
identified as a candidate, sensitive, or special status
species in local or regional plans, policies, or
regulations, or by the California Department of Fish
and Wildlife or U.S. Fish and Wildlife Service?
܆ ܈ ܆
b) Have a substantial adverse effect on any riparian
habitat or other sensitive natural community
identified in local or regional plans, policies,
regulations or by the California Department of Fish
and Wildlife or U.S. Fish and Wildlife Service?
܆ ܆ ܆
c) Have a substantial adverse effect on state or
federally protected wetlands (including, but not
limited to, marsh, vernal pool, coastal, etc.) through
direct removal, filling, hydrological interruption, or
other means?
܆ ܆ ܆
d) Interfere substantially with the movement of any
native resident or migratory fish or wildlife species
or with established native resident or migratory
wildlife corridors, or impede the use of native wildlife
nursery sites?
܆ ܆ ܆
e) Conflict with any local policies or ordinances
protecting biological resources, such as a tree
preservation policy or ordinance?
܆ ܆ ܈
f) Conflict with the provisions of an adopted Habitat
Conservation Plan, Natural Community
Conservation Plan, or other approved local,
regional, or state habitat conservation plan?
܆ ܆ ܈
DiDiDiDiDscscscscscususususussisisisisiononononon
The discussion section below is based on the Biological Resources Technical Letter Report for
the Salk Avenue Apartments Project in Carlsbad, San Diego County, California, prepared by
Michael Baker International and dated April 30, 2026, which is included as Appendix C.
a) Would the project have a substantial adverse effect, either directly or through habitat
modifications, on any species identified as a candidate, sensitive, or special status
Final Focused Initial Study/Mitigated Negative Declaration
Salk Avenue Apartments Project Page 4-3
species in local or regional plans, policies, or regulations, or by the California
Department of Fish and Wildlife or US Fish and Wildlife Service?
Less Than Significant Impact with Mitigation Incorporated.There is one special-status plant
species, thread-leaved brodiaea (federally threatened, state endangered, California Rare Plant
Rank 1B.1), and one special-status wildlife species, Crotch’s bumble bee (CBB; state candidate
endangered), that have potential to occur on a portion of the project site or within close proximity.
Additionally, one special-status wildlife species, coastal California gnatcatcher (federally
threatened, state species of concern), was detected on the project site during the general
biological field survey conducted by Michael Baker International on January 24, 2025 (see
Appendix C). It is noted that a coastal California gnatcatcher observation was also made in 2000
/ 2001 in association with the Fox Miller Project focused surveys, but this special-status species
was not detected during the 2003 focused surveys.
Special-Status Plant Species
One special-status plant species has the potential to occur on the project site: thread-leaved
brodiaea. Additionally, the US Fish and Wildlife Service (USFWS) mapped designated critical
habitat for thread-leaved brodiaea in the vicinity of the project site, including within the
northwestern portion of the project site (see Figure 4a, Biological Resources/Impacts).
However, the special-status plant species was not observed on the project site as part of the 2000
/ 2001 focused studies conducted in 2003 (RECON 2024), or the field survey conducted in 2025.
The project site was graded in 2007, resulting in primarily disturbed vegetation, and is mowed on
an annual basis.
A 0.33-acre patch of Diegan Coastal Sage Scrub in the northwest corner of the project site that is
designated as critical habitat for thread-leaved brodiaea is located approximately 100 feet beyond
the proposed development footprint. Project construction activities would not result in impacts to
this isolated patch of Diegan Coastal Sage Scrub, which is the only suitable habitat on the project
site for thread-leaved brodiaea. Therefore, no impact would occur to thread-leaved brodiaea or
its habitat.
The off-site sewer line would be located in paved areas of College Boulevard (Study Area-Off-
Site Sewer Line). The proposed construction footprint for the off-site sewer line does not contain
natural habitat or vegetation that could support special-status plant species. This area is fully
developed (paved roadway) and does not contain natural habitat or vegetation.
Special-Status Wildlife Species
Coastal California Gnatcatcher and Other Nesting Birds
One coastal California gnatcatcher was observed in the 0.33-acre patch of Diegan coastal sage
scrub in the northwest corner of the project site during the 2025 biological survey (Figure 4a,
Biological Resources/Impacts). As noted above, the habitat is approximately 100 feet beyond
the construction footprint of the proposed project and would not be disturbed. Accordingly, no
direct impacts to coastal California gnatcatcher would occur.
Several non-listed, sensitive bird species could potentially nest and/or forage over the site,
although the potential is low. There is potential for other nesting bird species to occur on-site in
the two on-site non-native, invasive fig trees to be removed, as well as in the isolated patch of
Final Focused Initial Study/Mitigated Negative Declaration
Salk Avenue Apartments Project Page 4-4
Diegan coastal sage scrub. Nesting birds may also potentially occur in trees adjacent to the
project site and the College Boulevard sewer replacement location (Study Area-Off-Site Sewer
Line).
Removal of the two fig trees could potentially directly affect nesting birds, while construction noise
has potential to indirectly affect nesting birds in the isolated patch of Diegan coastal sage scrub
and off-site trees. Implementation of mitigation measure (MM) BIO-1 would reduce impacts to
nesting birds, including coastal California gnatcatcher, to less than significant levels.
Crotch’s Bumble Bee
The closest location of the species is documented in the California Natural Diversity Database
(CNDDB), with two occurrences of CBB in 2024 noted approximately 2.5 miles north of the project
site at Lake Calavera Preserve. However, no individuals or nests of CBB were observed on or
adjacent to the project site during the general biological survey for the project on January 24,
2025. Because of (1) the presence of nectaring sources (i.e., food sources) present on and near
the project site, (2) the presence of other bumble bees on the project site during the January 24,
2025 biological survey (a yellow-faced bumble bee [Bombus vosnesenskii]), and (3) two known
CNDDB identifications of CBB within approximately 2.5 miles of the project site, there is moderate
potential for CBB to occur on the project site, although likely only within the 0.33-acre patch of
Diegan coastal sage scrub in the northwest corner of the project site. This limited area of habitat
supports nectaring sources that may be used by foraging CBB and soils that could provide nesting
and overwintering habitat. The project’s proposed off-site sewer line replacement would be
located in paved areas of College Boulevard and does not contain natural habitat or vegetation
that could support CBB.
Although no direct impacts to CBB individuals or nests are expected from the project due to lack
of suitable nectaring sources for foraging and lack of nesting habitat, there is a potential for indirect
effects if the species is present in the 0.33-acre patch of Diegan Coastal Sage Scrub in the
northwest corner of the project site. Indirect impacts to CBB could occur from fugitive dust during
ground-disturbing construction activities. Such indirect impacts to CBB would be potentially
significant. However, implementation of MM BIO-2 would reduce potential indirect impacts to CBB
to less than significant levels.
Mitigation Measures:
MM BIO-1 Pre-Construction Nesting Bird Surveys, Avoidance, and Notification.If
construction activities are initiated during the bird nesting season (February 1–
August 31) involving removal of vegetation or other nesting bird habitat, including
abandoned structures and other man-made features, a pre-construction nesting
bird survey shall be conducted no more than three days prior to initiation of ground
disturbance and vegetation removal activities. The nesting bird pre-construction
survey shall be conducted on foot and shall include a 300-foot survey buffer around
the construction site. The survey shall be conducted by a biologist familiar with the
identification of avian species known to occur in southern California coastal
communities (i.e., qualified biologist). If active nests are found, an avoidance buffer
shall be determined by a qualified biologist in coordination with the City. The
avoidance buffer width will depend upon the species, the proposed work activity,
and existing disturbances associated with land uses outside of the site, which shall
Final Focused Initial Study/Mitigated Negative Declaration
Salk Avenue Apartments Project Page 4-5
be demarcated by the biologist with bright orange construction fencing, flagging,
construction lathe, or other means to demarcate the boundary. All construction
personnel shall be notified as to the existence of the buffer zone and to avoid
entering the buffer zone during the nesting season. No ground-disturbing activities
shall occur within the buffer until the biologist has confirmed that breeding/nesting
is completed, and the young have fledged the nest. Encroachment into the buffer
shall occur only at the discretion of the qualified biologist on the basis that the
encroachment will not be detrimental to an active nest. A report summarizing the
pre-construction survey(s) shall be prepared by a qualified biologist and shall be
submitted to the City prior to the commencement of construction activities.
If an active coastal California gnatcatcher nest is found during pre-construction
surveys, a minimum 500-foot no-disturbance buffer shall be established around
the nest. The buffer shall be clearly marked (e.g., with fencing or flagging) and
maintained until a qualified biologist confirms that the young have fledged, the nest
is no longer active, or that construction noise levels can be maintained below
60 dBA Leq at the nest site with a smaller buffer. In no circumstances shall a buffer
of less than 100 feet be used even with noise attenuation measures. Any reduction
in the 500-foot buffer must be supported by site-specific analysis by the qualified
biologist and approved by the City in consultation with the US Fish and Wildlife
Service.
Note: To mitigate the potential impact to California gnatcatcher or other nesting
birds, this mitigation measure shall be applied to land use and activities occurring
at the project site. No Pre-Construction Nesting Bird Surveys, Avoidance, and
Notification mitigation is required to implement the Study Area-Off-Site Sewer Line
portion of the project.
MM BIO-2 Crotch’s Bumble Bee Avoidance and Clearance Survey
x Focused Survey. Three on-site surveys for Crotch’s bumble bee (CBB) shall be conducted
prior to initiation of ground disturbing project activities to identify if the CBB is present
within the project site. This survey shall be conducted simultaneously with the blooming
period of the species’ recognized food plants, when the CBB is most active. Each survey
shall be spaced at least 2 weeks but no more than 4 weeks apart, corresponding with the
Colony Active Season for Bombus species (April–August). The surveying biologist shall
be familiar with the primary identification characteristics of the CBB and be proficient in
the methodology produced by the Xerces Society. The qualified biologist shall utilize a
telephoto lens or a sufficiently long macro lens to obtain high-quality photos of bumble
bees, sufficient for species identification, without having to capture and potentially harm
the bumble bees.
x Absence of Species. If no CBB are detected during the focused surveys, no further
measures shall be necessary.
x Presence of Species. If CBB are detected, then site-specific measures shall be
implemented to avoid take unless an Incidental Take Permit (ITP) for the species is
obtained from CDFW. Such avoidance measures shall include:
Final Focused Initial Study/Mitigated Negative Declaration
Salk Avenue Apartments Project Page 4-6
o If vegetation removal activities and initial ground-disturbing activities (i.e., clearing,
grubbing, and initial site grading) occur during the Queen and Gyne Flight Period
and Colony Active Period for these species (February–October), a qualified
biologist shall conduct daily biological monitoring. During monitoring, the qualified
biologist shall inspect suitable habitat for CBB activity within the day’s work area.
If the species is not detected, then project activities can proceed without further
biological monitoring that day.
o If the CBB is detected using nectar sources, then a no-disturbance buffer of at least
25 feet around the individual(s) shall be established, and the individual(s) shall be
monitored by a biological monitor until the CBB are confirmed to have left the area
on their own.
o If a CBB nest is detected where ground disturbance is proposed to occur, then a
minimum 30-foot no-disturbance buffer (with a buffer of up to 60 feet if disturbance
is substantial) around the nest shall be established. This buffer shall remain in
place until the nest senesces, which would occur after no nest activity observations
for three sequential days. The qualified biologist shall discuss the buffer with the
contractor to ensure that work areas, including ingress and egress routes, avoid
the CBB.
o If the project cannot avoid the established no-disturbance buffer(s) identified
above, the project applicant shall halt work within the buffer area and shall consult
with CDFW on appropriate avoidance actions and obtain an Incidental Take Permit
if necessary.
Note: To mitigate the potential impact to Crotch’s Bumble Bee (CBB), this
mitigation measure shall be applied to land use and activities occurring at the
project site. No CBB Avoidance and Clearance Survey mitigation is required to
implement the Study Area-Off-Site Sewer Line portion of the project.
b) Would the project have a substantial adverse effect on any riparian habitat or other
sensitive natural community identified in local or regional plans, policies, regulations
or by the California Department of Fish and Wildlife or U.S. Fish and Wildlife Service?
No Impact. The project site consists of the following vegetation communities/land cover types:
Diegan Coastal Sage Scrub, Disturbed Habitat, and Urban/Developed Land (Figure 4a,
Biological Resources/Impacts). The off-site improvement areas (including abutting the project
site in Salk Avenue and the off-site sewer line in College Boulevard) contain Disturbed Habitat
and Urban/Developed Land (Figure 4b, Biological Resources/Impacts – Off-Site Sewer Line).
Of these vegetation communities/land cover types, Diegan Coastal Sage Scrub is the only
sensitive vegetation community on the project site or off-site improvement areas, and it occurs in
an isolated 0.33-acre area in the northwest corner of the project site. However, as shown on
Figure 4a, this isolated patch of Diegan Coastal Sage Scrub is approximately 100 feet from the
proposed development footprint. Therefore, the project, and its limits of disturbance will avoid any
impact to this plant species. Furthermore, there is no riparian habitat on or near the project site
Final Focused Initial Study/Mitigated Negative Declaration
Salk Avenue Apartments Project Page 4-7
or off-site improvement areas. Therefore, no impact to riparian habitat and other sensitive natural
communities would occur.
Mitigation Measures: None
c) Would the project have a substantial adverse effect on state or federally protected
wetlands (including, but not limited to, marsh, vernal pool, coastal, etc.) through
direct removal, filling, hydrological interruption, or other means?
No Impact. There are no state or federally protected wetlands on or near the project site or off-
site improvement areas. Therefore, no impact to state or federally protected wetlands would
occur.
Mitigation Measures: None
d) Would the project interfere substantially with the movement of any native resident or
migratory fish or wildlife species or with established native resident or migratory
wildlife corridors, or impede the use of native wildlife nursery sites?
No Impact.As the project site is surrounded by urban uses, including Salk Avenue, commercial
buildings, and the TaylorMade golf facility, there are no landscape features or vegetative cover
that would support wildlife movement or native wildlife nursery sites within the project site. The
project site is further characterized by open, exposed areas that lack suitable cover and resources
that are typically associated with wildlife movement areas. Additionally, the off-site improvement
areas occur within developed roadways (Salk Avenue and College Boulevard) with no landscape
features or vegetative cover that would support wildlife movement or native wildlife nursery sites.
Common birds and mammals might move through the site to forage and during dispersal
activities; however, they would not be expected to use the site as a wildlife corridor, linkage, or
specific travel route to and from nursery sites or other important resources.
The project site, off-site improvement areas, and project vicinity do not support wildlife movement
or native wildlife nursery sites. Accordingly, the project would not interfere substantially with the
movement of any native resident or migratory fish or wildlife species or with established native
resident or migratory wildlife corridors, or impede the use of native wildlife nursery sites. Thus, no
impacts to wildlife movement or native wildlife nursery sites would occur.
Mitigation Measures: None
e) Would the project conflict with any local policies or ordinances protecting biological
resources, such as a tree preservation policy or ordinance?
Less Than Significant Impact. CMC Section 11.12.140, Heritage Trees, and Section 11.12.090,
Permits Required for Tree Removal and Maintenance, regulates trees located on public streets,
trees with notable historic interest, and trees of unusual species or size. There are no City
protected trees on the project site or off-site improvement areas.
There are two non-native, invasive fig trees within the proposed project footprint that would be
removed; however, neither fig tree is in the public right-of-way, of notable historic interest, or of
an unusual species or size, pursuant to CMC Section 11.12.140. Therefore, these fig trees are
Final Focused Initial Study/Mitigated Negative Declaration
Salk Avenue Apartments Project Page 4-8
not considered protected trees. No trees would be impacted by the construction of the off-site
sewer line in College Boulevard. Thus, the project would not conflict with any local policies or
ordinances protecting biological resources, and impacts would be less than significant.
Mitigation Measures: None
f) Would the project conflict with the provisions of an adopted habitat conservation
plan, natural community conservation plan, or other approved local, regional, or state
habitat conservation plan?
Less Than Significant Impact.The project site and off-site improvement areas are within the
boundaries of the City’s Habitat Management Plan (HMP) in Special Resource Area (SRA) 1;
however, the project site is not within the HMP Hardline Conservation Area or HMP Proposed
Hardline Conservation Area, which is identified in the HMP for conservation. The northernmost
approximately 40 feet of the existing driveway that provides access to the project site, which would
be improved as part of the proposed project and serve as egress/ingress for the project site, is
within 100 feet of a HMP Proposed Hardline Conservation Area (Figure 5, Plans and Policies).
The HMP includes Adjacency Standards that are designed to prevent negative effects to urban
wildlife preserve systems and include fire management; erosion control; landscaping restrictions;
fencing, signs, and lighting; and predator and exotic species control (pursuant to Section F.3 of
the HMP). The following describes the project’s adherence to the HMP Adjacency Standards, as
required by the City’s conditions of approval for the project:
x Fire Management:Proposed improvements associated with the northernmost
approximately 40 feet of the existing driveway would be subject to applicable fuel
modification zone requirements for fire management. The City’s Fire Department has
reviewed and preliminarily approved the proposed fuel modification zones for the project.
Additionally, it is noted that the fuel modification area required for the proposed project
would not encroach into a HMP Proposed Hardline Conservation Area. As such, the
project would adhere to the HMP Adjacency Standards.
x Erosion Control:Construction of the project shall include implementation of standard
construction best management practices, as well as implementation of a project-specific
Storm Water Pollution Prevention Plan, which would minimize erosion during construction.
The project landscape plan shall ensure that project site slopes are stabilized after
construction is completed. As such, the project would not result in increased storm water
runoff volume or velocity into the preserve, and the project would adhere to the HMP
Adjacency Standards.
x Landscaping Restrictions:The project landscape plan shall be reviewed by the City
Planning Division prior to issuance of a grading permit to ensure that no non-native,
invasive plant species are proposed. Drought-tolerant plant species shall also be used on-
site to minimize irrigation runoff potential. The project shall limit the amount of fertilization
of ornamental plants on the project site that could drain toward the HMP Proposed
Hardline Conservation Area to the north of Salk Avenue. As such, the project would adhere
to the HMP Adjacency Standards.
Final Focused Initial Study/Mitigated Negative Declaration
Salk Avenue Apartments Project Page 4-9
x Fencing, Signs, and Lighting:The Project shall not include fencing within the HMP
Preserve, and as such, the project would not impede wildlife movement within the
preserve. No signs prohibiting entrance into the preserve would be required on the project
site, as Salk Avenue is located in between the project site and the closest HMP Proposed
Hardline Conservation Area. However, future project residences shall receive educational
brochures upon moving in to deter human and pet access into the preserve. Streetlighting
currently exists along Salk Avenue. The project shall include security lighting along the
driveway; however, proposed lighting would be low pressure sodium, directed downward,
and shielded away from the HMP Proposed Hardline Conservation Area. As such, the
project would adhere to the HMP Adjacency Standards.
x Predator and Exotic Species Control:As previously stated, future project residences
shall receive educational brochures upon moving in regarding the nearby HMP Preserve
to deter human and pet access into the preserve. As such, the project would adhere to the
HMP Adjacency Standards.
With adherence to these standards, the proposed project would not conflict with the provisions of
the HMP, including its Adjacency Standards, and impacts would be less than significant.
Mitigation Measures: None
l
6RXUFH(VUL$UF*,62QOLQH6DQ'LHJR&RXQW\1HDUPDS,PDJHU\
%LRORJLFDO5HVRXUFHV,PSDFWV
)LJXUHD
)2&86(',601'
6$/.$9(18($3$570(176352-(&7
-
1
?
?
6
D
Q
W
F
D
K
X
E
?
V
D
Q
G
F
D
I
V
?
+
U
R
R
W
?
3
'
$
7
$
?
B
+
D
Q
R
Y
H
U
&
D
U
O
V
E
D
G
?
*
,
6
?
$
3
5
;
?
+
D
Q
R
Y
H
U
6
D
O
N
$
Y
H
1
5
?
+
D
Q
RY
H
U
6
D
O
N
$
Y
H
1
5
D
S
U
[
/HJHQG
&RDVWDO&DOLIRUQLD*QDWFDWFKHU
6WXG\$UHDIW%XIIHU
2Q6LWH/LPLWVRI'LVWXUEDQFH
2II6LWH/LPLWVRI'LVWXUEDQFH
&ULWLFDO+DELWDW
7KUHDGOHDYHG%URGLDHD%URGLDHDILOLIROLD
9HJHWDWLRQ/DQG8VHV3URMHFW6LWH
'LHJDQ&RDVWDO6DJH6FUXE$FUHV
'LVWXUEHG+DELWDW$FUHV
8UEDQ'HYHORSHG$FUHV
9HJHWDWLRQ/DQG8VHVIW6WXG\$UHD
&RDVWDO6DJH6FUXE$FUHV
'LHJDQ&RDVWDO6DJH6FUXE$FUHV
'LVWXUEHG+DELWDW$FUHV
(XFDO\SWXV:RRGODQG$FUHV
8UEDQ'HYHORSHG$FUHV
86)HHW
6DON$YH
)H
U
P
L
&
W
&RPPHUFLDO
&RPPHUFLDO
7D\ORU0DGH*ROI
)DFLOLW\
l
6RXUFH(VUL$UF*,62QOLQH6DQ'LHJR&RXQW\1HDUPDS,PDJHU\
%LRORJLFDO5HVRXUFHV,PSDFWV2II6LWH6HZHU/LQH
)LJXUHE
)2&86(',601'
6$/.$9(18($3$570(176352-(&7
-
1
?
?
6
D
Q
W
F
D
K
X
E
?
V
D
Q
G
F
D
I
V
?
+
U
R
R
W
?
3
'
$
7
$
?
B
+
D
Q
R
Y
H
U
&
D
U
O
V
E
D
G
?
*
,
6
?
$
3
5
;
?
+
D
Q
R
Y
H
U
6
D
O
N
$
Y
H
1
5
?
+
D
Q
RY
H
U
6
D
O
N
$
Y
H
1
5
D
S
U
[
/HJHQG
6HZHU
&ROOHJH%OYG6HZHU5HSODFHPHQW/LPLWVRI'LVWXUEDQFH
6WXG\$UHDIW%XIIHUIURP/LPLWVRI'LVWXUEDQFH
9HJHWDWLRQ&RPPXQLWLHV/DQG8VHVIW6WXG\$UHD
8UEDQ'HYHORSHG$FUHV
)HHW
(O&DPLQR5HDO
&R
O
O
H
J
H
%
O
Y
G
6XQQ\&
U
H
H
N
5
G
)R
[
W
D
L
O
/
R
R
S
6SHQ
F
H
U
/
Q
%D
G
J
H
U
/
Q
&RPPHUFLDO
5HVLGHQWLDO
&RPPXQLW\
8QGHU&RQVWUXFWLRQ
5HVLGHQWLDO
&RPPXQLW\
5HVLGHQWLDO
&RPPXQLW\
l
)HHW
6HZHU/LQH
3URMHFW6LWH
/LPLWVRI'LVWXUEDQFH
&RDVWDO=RQH
&LW\RI&DUOVEDG+DELWDW0DQDJHPHQW3ODQ
([LVWLQJ+DUGOLQH
6WDQGDUGV$UHD
3URSRVHG+DUGOLQH
)2&86(',601'
6$/.$9(18($3$570(176352-(&7
6RXUFH(VUL$UF*,62QOLQH86):6&LW\RI&DUOVEDG&LW\RI&DUOVEDG6DQ'LHJR&RXQW\1HDUPDS,PDJHU\
&ROOHJH%OYG
)DUDGD\
$
Y
H
(O&DPLQR5HDO
/HJHQG
-
1
?
?
6
D
Q
W
F
D
K
X
E
?
V
D
Q
G
F
D
I
V
?
+
U
R
R
W
?
3
'
$
7
$
?
B
+
D
Q
R
Y
H
U
&
D
U
O
V
E
D
G
?
*
,
6
?
$
3
5
;
?
+
D
Q
R
Y
H
U
6
D
O
N
$
Y
H
1
5
?
+
D
Q
RY
H
U
6
D
O
N
$
Y
H
1
5
D
S
U
[
)LJXUH
6DON$YH
3ODQVDQG3ROLFLHV
3ULHV
W
O
\
'
U
5HVLGHQWLDO&RPPXQLW\
8QGHU&RQVWUXFWLRQ
5HVLGHQWLDO
&RPPXQLW\
&RPPHUFLDO7D\ORU0DGH
*ROI)DFLOLW\
&RPPHUFLDO
&RPPHUFLDO
Final Focused Initial Study/Mitigated Negative Declaration
Salk Avenue Apartments Project Page 5-1
5.0 LIST OF PREPARERS
Lead Agency – City of Carlsbad
Community Development Department
1635 Faraday Avenue
Carlsbad, CA 92008
Kyle Van Leeuwen, Senior Planner
442-339-2611
Michael Baker International, Inc.
Bob Stark, AICP, Principal-in-Charge
Melissa Whittemore, Project Manager
Audrey Tamayo, Environmental Planner
Ryan Henry, Principal Biologist
Marisa Flores, Senior Biologist
Samantha Martinez, Biologist
Connor Lance, GIS Specialist
Ana Cotham, Technical Editor
Final Focused Initial Study/Mitigated Negative Declaration
Salk Avenue Apartments Project Page 6-1
66666....00000 RRRRREEEFFFEEERRREEEEENNNCCCCCEEEEESSSSS
Carlsbad, City of. 1999.Habitat Management Plan for Natural Communities in the City of
Carlsbad.
Carlsbad, City of. 2016.Landscape Manual –Policies and Requirements.
Carlsbad, City of. 2017. City of Carlsbad General Plan Open Space, Conservation, and
Recreation Element.
Carlsbad, City of. 2023. Housing Element Implementation and Public Safety Element Update
Supplemental Environmental Impact Report.
Michael Baker International. 2026. Biological Resources Technical Letter Report for the Salk
Avenue Apartments Project in Carlsbad, San Diego County, California.
RECON. 2001. Revised Biological Technical Report for the Fox Property, Carlsbad, California.
RECON. 2004. Biological Resources Survey Update and Project Impact Revisions for Fox-Miller
Property, Carlsbad, California.
Final Focused Initial Study/Mitigated Negative Declaration
Salk Avenue Apartments Project Appendices
APPENDIX C:
Biological Resources
Technical Letter Report
5050 Avenida Encinas, Suite 260 | Carlsbad CA 92008
Office: 760-476-9193
April 30, 2026 JN 205484
JOE GAMBILL
Hanover Company
11611 San Vicente Boulevard, Suite 740
Los Angeles, California 90049
SUBJECT: Biological Resources Technical Letter Report for the Salk Avenue Apartments
Project in Carlsbad, San Diego County, California
Dear Mr. Gambill,
Michael Baker International is pleased to submit this technical letter report documenting the
results of a biological resources assessment for the proposed Salk Avenue Apartments Project
(the project), which proposes the development of multifamily residential units in the City of
Carlsbad, California. This report is intended to satisfy the requirements of the California
Environmental Quality Act (CEQA) and the City of Carlsbad Habitat Management Plan (HMP).
1.0 PROJECT LOCATION
The 9.8-acre project site is located in the City of Carlsbad, California, south of Salk Avenue, west
of El Camino Real, east of College Boulevard, and north of Faraday Avenue (Assessor’s Parcel
Number 212-021-04-00). The project occurs within Township 12 South, Range 04 West of the
San Luis Rey 7.5-minute United States Geological Survey (USGS) topographic quadrangle map
(Attachment A, Figure 1, Regional and Project Vicinity). The project site is within the boundaries
of the City of Carlsbad HMP and must be in compliance with the plan.
2.0 PROJECT DESCRIPTION
The applicant proposes the construction and occupation of a 397-dwelling unit apartment complex
on the approximately 9.8-acre project site (refer to Attachment 2a, Project Site). The residential
building would be five stories with a maximum building height of 59 feet, with allowed architectural
projections up to 74 feet, 7 inches. The building configuration would result in several outdoor
courtyard areas with landscaping and hardscape amenities such as seating areas. A five-level
aboveground parking garage would be constructed to the south of the residential building. Surface
parking would also be provided along the perimeter of the residential building. Site ingress/egress
would occur via a new driveway from Salk Avenue.
The property was previously graded around 2007 to create a development pad for the Fox Miller
Project but otherwise remains undeveloped. The proposed project would develop 6.35 acres of
the project site (Limits of Disturbance) (refer to Attachment A, Figure 2a, Project Site). Off-site
improvements for the proposed project would replace approximately 875 linear feet of sewer
Biological Resources Technical Letter Report April 30, 2026
Salk Avenue Apartments Project Page 2
pipeline beneath College Boulevard between El Camino Real and Sunny Creek Road (refer to
Attachment A, Figure 2b, College Blvd Sewer Line Extension Location).
3.0 EXISTING SITE CONDITIONS
The project site and a 100-foot buffer (the study area) were evaluated for the proposed project
site (refer to Attachment A, Figure 4a, Study Area). A 25-foot study area buffer was applied to the
College Boulevard sewer line improvement (off-site improvement area; refer to Attachment A,
Figure 4b, Study Area-Off-Site Sewer Line). Elevations on-site range from approximately 170 feet
in the northwest along Salk Avenue to 275 feet along the southeastern portion of the project site.
Elevations for the off-site improvement area range from 80 feet to 110 feet. Refer to Attachment
B for representative photographs taken throughout the project site.
Soils on-site consist of the following types (USDA NRCS 2025; see Attachment A, Figure 3a,
USDA Soils):
x AtC: Altamont Clay, 5 to 9 percent slopes
x AtE: Altamont Clay, 15 to 30 percent slopes, warm MAAT, MLRA 20
Soil properties in the off-site improvement area (Study Area-Off-Site Sewer Line) consist of the
following types (USDA NRCS 2025; see Attachment A, Figure 3b, USDA Soils-Off-Site Sewer
Line):
x Altamont clay, 9 to 15 percent slopes, warm MAAT, MLRA 20
x Altamont clay, 15 to 30 percent slopes, warm MAAT, MLRA 20
x Salinas clay, 2 to 5 percent slopes
x Tujunga sand, 0 to 5 percent slopes
3.1 Project Site History
The project site was previously evaluated as part of a larger property known as the Fox Miller
Property II (for the Fox Miller Project). In 2001, a Biological Technical Report was prepared by
RECON. Additionally, focused studies for thread-leaved brodiaea (Brodiaea filifolia) and coastal
California gnatcatcher (Polioptila californica californica) were conducted in 2003 (RECON 2004).
A Mitigated Negative Declaration was also prepared and adopted by the City of Carlsbad in 2002.
After approval of the Fox Miller Project, the Salk Avenue Apartments Project site was filled and
graded (circa. 2007) to create a development pad but has remained vacant and undeveloped.
The approval of the Fox Miller Project included mitigation for impacts on thread-leaved brodiaea.
During the 2003 focused surveys for the Fox Miller Project, a total of 19,100 thread-leaved
brodiaea plants were counted; however, none of these plants occurred within the Salk Avenue
Apartments Project study area. A coastal California gnatcatcher observation was made in
2000/2001, but this species was not detected during the 2003 RECON focused surveys.
Biological Resources Technical Letter Report April 30, 2026
Salk Avenue Apartments Project Page 3
3.2 City of Carlsbad Habitat Management Plan
The HMP provides a comprehensive, citywide, program to identify how the City of Carlsbad, in
cooperation with federal and state wildlife agencies, preserves the diversity of habitat and protect
sensitive biological resources in some areas, while allowing for development in other areas. The
City of Carlsbad’s HMP maps the distribution of vegetation communities and sensitive species
through the use of Focus Planning Areas – which are further broken down into HMP cores,
linkages and Special Resource Areas.
Certain naturally vegetated areas in the City of Carlsbad are too small, edge-effected, or isolated
to be considered biological cores or linkage areas but are nonetheless important to preserve
design or the conservation of particular species. These areas are described here as Special
Resource Areas (SRAs). SRA 1 lies between El Camino Real, Faraday Avenue, and College
Boulevard within Zone 5. It comprises slopes covered by grasslands and small patches of coastal
sage scrub. This area is known to support a major population of a Narrow Endemic plant species
(Brodiaea filifolia) and may support additional Narrow Endemic species. Although SRA 1 is
isolated from biological core and linkage areas, conservation of Narrow Endemic plant
populations within the SRA is considered important for species conservation.
The project site is a covered activity under the City of Carlsbad HMP and is located in SRA 1.
However, the project site is not within a HMP Hardline Conservation Area or HMP Proposed
Hardline Conservation Area. There is no HMP Hardline Conservation Area located within or
between the El Camino Real, Faraday Avenue, and College Boulevard area. There is a HMP
Proposed Hardline Conservation Area located to the north of the project site, across Salk Avenue
(refer to Attachment A, Figure 6, Plans and Policies). The northernmost 40 feet of the existing
driveway that provides access to the project site and would be improved as part of the proposed
project and serve as egress/ingress for the project is within 100 feet of a Proposed Hardline area
(Attachment A, Figure 6, Plans and Policies) and may be subject to the HMP Adjacency
Standards. The HMP Adjacency Standards ensure that the project addresses potential indirect
effects and incorporates measures for fire management, erosion control, landscaping,
fencing/signs/lighting, and predator/exotic species control.
4.0 METHODS
4.1 Literature Review
Prior to conducting the field survey, Michael Baker conducted a thorough literature review and
records search to characterize existing site conditions and assess the potential for special-status1
biological resources to occur that might pose a constraint to implementation of the project. A query
of the California Natural Diversity Database (CNDDB) (CNDDB 2025) and California Native Plant
Society (CNPS) Online Inventory of Rare and Endangered Plants of California (CNPS 2025) was
conducted to obtain a list of special-status plant and wildlife species occurrence records within
1 Special-status refers to plant and wildlife species that are federal or state-listed, proposed, or candidates; plant
species that have been designated a California Rare Plant Rank by the California Native Plant Society; wildlife
species that are designated by the California Department of Fish and Wildlife as Fully Protected, or Species of Special
Concern; and other state or locally rare vegetation communities.
Biological Resources Technical Letter Report April 30, 2026
Salk Avenue Apartments Project Page 4
the following USGS 7.5-minute quadrangle maps: San Luis Rey, Las Pulgas Canyon, Morro Hill,
Bonsall, Oceanside, San Marcos, Encinitas, and Rancho Santa Fe.
The U.S. Fish and Wildlife Service (USFWS) IPaC online database was also reviewed to identify
special-status species and other resources, such as Critical Habitat, known or expected to occur
on the project site or within the immediate vicinity (USFWS 2025). Due to the results listed in the
IPaC report, the USFWS Critical Habitat for Threatened & Endangered Species mapping tool
(USFWS 2025) was accessed to determine the location of designated Critical Habitat in relation
to the project site. Other sources of information about the project site and surrounding area include
the U.S. Department of Agriculture (USDA), Natural Resources Conservation Service (NRCS)
Web Soil Survey (USDA NRCS 2025) and the USFWS National Wetlands Inventory (USFWS
2025).
All the information obtained informed the understanding of the project site and assisted with the
field survey and subsequent analysis. The results presented in this report provide a detailed
assessment of the suitability of the habitat on-site to support special-status plant and wildlife
species and other sensitive natural resources.
4.2 Habitat Assessment/Field Survey
Michael Baker biologists Marisa Flores and Samantha Martinez conducted a field assessment on
January 24, 2025, between 8:15 a.m. and 10:15 a.m. to document existing conditions, conduct a
habitat assessment for special-status plant and wildlife species and sensitive natural
communities, and determine the presence of aquatic resources within the project site. Weather
conditions were generally sunny and calm with temperatures ranging from 56 to 69 degrees
Fahrenheit.
The project site and a 100-foot buffer (the study area) was evaluated. Classification of the on-site
vegetation communities and other land uses is based on the descriptions of terrestrial vegetation
classification systems described in the Draft Vegetation Communities of San Diego County
(Oberbauer et al. 2008) which is based on Holland (1993) classifications. In addition, site
characteristics such as soil condition, topography, hydrology, anthropogenic disturbances,
indicator species, condition of on-site vegetation communities, and the presence of potentially
regulated jurisdictional features were noted. A formal aquatic resources delineation was not
conducted. Michael Baker used geographic information systems (GIS) software to digitize the
mapped vegetation communities and overlayed the data onto an aerial photograph to further
analyze existing conditions and quantify the acreages of each vegetation community on-site.
All plant and wildlife species observed during the field survey were recorded in a field notebook.
Plant species observed were identified by visual characteristics and morphology in the field while
unusual and less familiar plant species were photographed and later identified using taxonomic
guides. Plant species nomenclature and taxonomy follows The Jepson Manual: Vascular Plants
of California, second edition (Baldwin et al. 2012) and scientific names are provided immediately
following common names of plant species (first reference only). Wildlife detections were made
through aural and visual detection, as well as observation of signs including scat, trails, tracks,
burrows, and nests.
Biological Resources Technical Letter Report April 30, 2026
Salk Avenue Apartments Project Page 5
Field guides used to assist with identification of species during the field survey included The Sibley
Guide to Birds (Sibley 2014) for birds, A Field Guide to Western Reptiles and Amphibians
(Stebbins 2003) for herpetofauna, and A Field Guide to Mammals of North America (Reid 2006)
for mammals. Wildlife species taxonomy follows the North American Butterfly Association (NABA)
(NABA 2025) for butterflies, the Society for the Study of Amphibians and Reptiles (Crother et al.
2017) for herpetofauna, the American Ornithological Society for birds (Chesser et al. 2023), and
Mammal Species of the World (Wilson et al. 2005) for mammals. Scientific names are provided
immediately following common names of wildlife species (first reference only).
The potential for special-status species to occur in the study area was evaluated based on each
species’ known geographic distribution and elevation range; species-specific habitat requirements
(e.g., vegetation communities/land covers, soils, hydrology, slope/aspect, and other
requirements); life history traits (e.g., disturbance tolerance); and Michael Baker biologists’
expertise, knowledge, and best professional judgement. Current and historic records of species
identified during the literature review were also considered during the analysis; however, a
species’ potential to occur determination was not solely based on the age or location of these
previously documented records. The potential to occur categories used in this analysis are
defined as follows:
x Present:The species was observed or detected within the study area.
x Expected:The study area is within the known geographic distribution and elevation range
of the species, there is high quality suitable habitat present (considering vegetation, soils,
and other factors), and there is viable landscape connectivity to a local, known extant
population(s) or sighting(s) within the study area.
x Moderate:The study area is within the known geographic distribution and elevation range
of the species, there is moderate to low quality suitable habitat present (considering
vegetation, soils, and other factors), and there is limited or no landscape connectivity to a
local, known, extant population.
x Not Expected:The study area is outside the known geographic distribution and elevation
range of the species, there is marginal to no suitable habitat, and there is no connectivity
to known, extant populations.
x Absent:The species was not detected during focused or agency-approved protocol
surveys.
5.0 RESULTS
5.1 Vegetation Communities and Land Covers
The project site supports the following land cover types: Diegan Coastal Sage Scrub, Disturbed
Habitat, and Urban/ Developed as summarized in Table 1, Vegetation Communities and Land
Cover Types, and depicted in Attachment A, Figure 5a, Vegetation Communities/Land Uses and
Figure 5b, Vegetation Communities/Land Uses – Off-Site Sewer Line.
Biological Resources Technical Letter Report April 30, 2026
Salk Avenue Apartments Project Page 6
TABLE 1. VEGETATION COMMUNITIES AND LAND COVER TYPES
Vegetation
Community/
Land Cover Type Project Site (Acres)
Project Site
+ 100-foot
Study Area
(Acres)
Off-site
Sewer
Improvement
Area LOD
(Acres)
Off-site Sewer
Improvement
Area LOD + 25-
foot Study Area
(Acres)
32530 Diegan Coastal
Sage Scrub 0.33 0.95 - -
1130 Disturbed Habitat 6.76 9.38 - 0.07
12000 Urban/
Developed 2.69 6.25 0.85 2.78
32500 Coastal Sage
Scrub - 0.29 - -
79100 Eucalyptus
Woodland - 0.19 - -
TOTAL 9.78 17.06 0.85 2.85
Notes:
LOD = Limits of Disturbance
32530 Diegan Coastal Sage Scrub
The Diegan Coastal Sage Scrub land cover mapping unit is located along the northwestern corner
of the project site compromising of a basin vegetated with coyote brush scrub. An undisturbed
area of Diegan Coastal Sage Scrub was also present south of the project site within the study
area.
Diegan Coastal Sage Scrub land cover is not impacted by the College Boulevard sewer line
extension (Study Area-Off-Site Sewer Line). This area is fully developed (paved roadway) and
does not contain natural habitat or vegetation.
1130 Disturbed Habitat
The disturbed habitat is primarily escaped ornamentals, scattered coyote brush (Baccharis
pilularis), and non-native grasses within the rough graded pad. This area is routinely mowed and
grass species were not identifiable during the site visit. Additional Disturbed Habitat was observed
within the study area west of the project site and was comprised of non-native grasses and
artichoke thistle (Cynara cardunculus).
The disturbed habitat is also within the off-site study area, west of the off-site improvement area
limits of disturbance (Study Area-Off-Site Sewer Line).
12000 Urban/Developed
This land cover consists of irrigated ornamental landscaping around the perimeter of the project
site and developments to the east and west.
Biological Resources Technical Letter Report April 30, 2026
Salk Avenue Apartments Project Page 7
The urban/ developed land cover also includes the off-site limits of disturbance along College
Boulevard between El Camino Real and Sunny Creek Road (Study Area-Off-Site Sewer Line).
79100 Eucalyptus Woodland
The eucalyptus woodland is located just southwest of the project site, within the study area. It is
comprised of a woodland area dominated by gum trees (Eucalyptus spp.) and may provide
suitable nesting habitat for large birds and raptors.
Eucalyptus Woodlands is not impacted by the College Boulevard sewer line extension (Study
Area-Off-Site Sewer Line). This area is fully developed (paved roadway) and does not contain
natural habitat or vegetation.
5.2 General Floral Inventory
A total of 22 species of native or naturalized plants, 7 native (32 percent) and 15 non-native
(68 percent), were recorded on-site. Attachment C, Species Compendiums, contains a list of
observed plant species.
General native or naturalized plants are not impacted by the College Boulevard sewer line
extension (Study Area-Off-Site Sewer Line). This area is fully developed (paved roadway) and
does not contain natural habitat or vegetation.
5.3 General Wildlife Inventory
A total of 23 wildlife species were observed during the field survey, 21 native (91 percent) and
2 non-native (9 percent). The most commonly occurring birds during the field survey included
California towhee (Melo one crissalis), American crow (Corvus brachyrhynchos), and house finch
(Haemorhous mexicanus). Attachment C contains a full list of wildlife species detected on the
project site.
General wildlife species are not impacted by the College Boulevard sewer line extension (Study
Area-Off-Site Sewer Line). This area is fully developed (paved roadway) and does not contain
natural habitat or vegetation.
5.4 Special-Status Biological Resources
Sensitive Natural Communities
Eleven natural communities considered sensitive by the CDFW were reported in the CNDDB from
the eight USGS 7.5-minute quadrangle map regions surrounding and including the San Luis Rey
map. These include:
x Coastal Brackish Marsh
x Maritime Succulent Scrub
x San Diego Mesa Claypan Vernal Pool
Biological Resources Technical Letter Report April 30, 2026
Salk Avenue Apartments Project Page 8
x San Diego Mesa Hardpan Vernal Pool
x Southern Coastal Salt Marsh
x Southern Cottonwood Willow Riparian Forest
x Southern Maritime Chaparral
x Southern Riparian Forest
x Southern Riparian Scrub
x Southern Sycamore Alder Riparian Woodland
x Southern Willow Scrub
The project site consists of Diegan Coastal Sage Scrub, Disturbed Habitat, and Urban/Developed
land cover types. The Diegan Coastal Sage Scrub is located in the northwest corner of the project
site and outside the limits of disturbance. There are no natural communities considered sensitive
by the CDFW within the project site.
There are no sensitive natural communities impacted by the College Boulevard sewer line
extension (Study Area-Off-Site Sewer Line). This area is fully developed (paved roadway) and
does not contain natural habitat or vegetation.
Special-Status Plant Species
A total of 68 special-status plant species were reported in the CNDDB and CNPS Online Inventory
of Rare and Endangered Plants of California from the nine USGS 7.5-minute quadrangle map
regions surrounding and including the San Luis Rey map. After a review of specific habitat
preferences, known distributions, and elevation ranges, one special-status plant species has the
potential to occur within the study area: thread-leaved brodiaea. However, Attachment D contains
a summary of special-status species with their potential to occur on the project site.
There are no sensitive natural communities impacted by the College Boulevard sewer line
extension (Study Area-Off-Site Sewer Line). This area is fully developed (paved roadway) and
does not contain natural habitat or vegetation.
Special-Status Wildlife Species
Sixty-four special-status wildlife species were reported in the CNDDB from the eight USGS
7.5-minute quadrangle map regions surrounding and including the San Luis Rey map. A California
gnatcatcher (Polioptila californica californica FT, SSC, Covered) was observed within the
northwest corner of the project site during the survey (Attachment A, Figure 5a, Vegetation
Communities and Other Land Uses). The closest location of Crotch’s bumble bee (Bombus
crotchii SCE) is documented in the CNDDB, with two occurrences of the species in 2024 noted
approximately 2.5 miles north of the project site at Lake Calavera Preserve. Therefore, because
of (1) the presence of nectaring sources (i.e., food sources) present on and near the project site,
(2) the presence of other bumble bees on the project site during the January 24, 2025 biological
survey (a yellow-faced bumble bee [Bombus vosnesenskii]), and (3) two known CNDDB
identifications of Crotch’s bumble bee within approximately 2.5 miles of the project site, there is
Biological Resources Technical Letter Report April 30, 2026
Salk Avenue Apartments Project Page 9
moderate potential for Crotch’s bumble bee to occur on the project site, although likely only within
the 0.33-acre patch of Diegan coastal sage scrub in the northwest corner of the project site.
No other special-status wildlife species were observed during the field survey and are not
expected to occur on the project site due to a lack of suitable habitat and a review of specific
habitat preferences, known distributions, and elevation ranges. Attachment D contains a summary
of the special-status species with their potential to occur on the project site.
There are no special-status wildlife species impacted by the College Boulevard sewer line
extension (Study Area-Off-Site Sewer Line). This area is fully developed (paved roadway) and
does not contain natural habitat or vegetation.
Critical Habitat
Under the federal Endangered Species Act (ESA), Critical Habitat may be established for species
listed as threatened or endangered. Critical Habitat refers to specific areas within the geographical
range of a species that were occupied at the time it was listed that contain the physical or
biological features that are essential to the survival and eventual recovery of that species and that
may require special management considerations or protection, regardless of whether the species
is still extant in the area. Areas that were not known to be occupied at the time a species was
listed can also be designated Critical Habitat if they contain one or more of the physical or
biological features that are essential to that species’ conservation and if the other areas that are
occupied are inadequate to ensure the species’ recovery.
In the event that a project may result in take or adverse modification to a listed species’ designated
Critical Habitat, a project proponent may be required to engage in suitable mitigation. However,
consultation for impacts to Critical Habitat is only required when a project has a federal nexus.
This may include projects that occur on federal lands, require federal permits (e.g., Clean Water
Act [CWA] Section 404 permit), or receive any federal oversight or funding. If there is a federal
nexus, then the federal agency that is responsible for providing funds or permits would be required
to consult with the USFWS under the ESA.
The USFWS has mapped designated Critical Habitat for thread-leaved brodiaea (Brodiaea
filifolia) within the northwestern portion of the project site (Attachment A, Figure 7a, Biological
Resource Impacts). Soils on the project site are comprised of fill dirt brought in around 2007 for
the Fox Miller Project. Although some clay soils were observed on the margins of the project site,
soils within the majority of the project site appeared to be comprised of loam. Based on the
focused studies conducted by RECON in 2003, the species was not present on the project site
when habitat and soils would have been more suitable for the species. Routine soil and vegetation
disturbances also occur on the landscaped slopes and pad. Based on the historic and current site
disturbances the project site does not display the physical and biological characteristics for Critical
Habitat.
Biological Resources Technical Letter Report April 30, 2026
Salk Avenue Apartments Project Page 10
State and Federal Jurisdictional Aquatic Features
Four key agencies regulate activities within coastal streams, wetlands, and riparian areas in
California. The U.S. Army Corps of Engineers (USACE) Regulatory Branch regulates activities
that result in the discharge of dredged or fill material into waters of the U.S., including wetlands,
pursuant to Section 404 of the CWA and Section 10 of the Rivers and Harbors Act. Of the state
agencies, the Regional Water Quality Control Board (RWQCB) regulates discharges to waters of
the State, including wetlands, pursuant to Section 401 of the CWA, Section 13263 of the California
Porter-Cologne Water Quality Control Act, and State Wetland Definition and Procedures for
Discharges of Dredged or Fill Material to Waters of the State; the CDFW regulates alterations to
lakes, streambeds, and associated riparian habitat pursuant to Section 1600 et seq. of the CFGC;
and the California Coastal Commission (CCC) regulates land use in the coastal zone pursuant to
the California Coastal Act (CCA).
Based on a review of aerial photographs, USGS 7.5-minute quadrangle maps, USFWS National
Wetland Inventory maps, and observations made during the field survey, there is one potential
jurisdictional aquatic resource in the project site. A vegetated basin, created during initial site
grading in 2007, was present at the northwest corner of the project site. A jurisdictional delineation
was not conducted as part of the 2025 biological investigations since there would be no effects
from the proposed project.
5.5 Wildlife Corridors and Habitat Linkages
Wildlife corridors link areas of suitable habitat that are otherwise separated by areas of
non-suitable habitat such as rugged terrain, changes in vegetation, or human disturbance. Wildlife
corridors are essential to the regional ecology of a species because they provide avenues of
genetic exchange and allow animals to access alternative territories as dictated by fluctuating
population densities. Fragmentation of open space areas by urbanization creates “islands” of
wildlife habitat that are more or less isolated from each other. Corridors mitigate the effects of this
fragmentation by (1) allowing animals to move between remaining habitats, thereby permitting
depleted populations to be replenished and promoting genetic exchange; (2) providing escape
routes from fire, predators, and human disturbances, thus reducing the risk of catastrophic events
(such as fire or disease) that could lead to local extinction; and (3) serving as travel routes for
individual animals as they move within their home ranges in search of food, water, mates, and
shelter.
Wildlife corridors are usually bounded by urban land areas or other areas unsuitable for wildlife.
The corridor generally contains suitable cover, food, and/or water to support species and facilitate
movement while in the corridor. Larger, landscape-level corridors (often referred to as “habitat or
landscape linkages”) can provide both transitory and resident habitat for a variety of species.
Although it is commonly used as a synonym for wildlife corridor, a habitat linkage refers to a more
substantial, or wider, land connection between two habitat areas. Habitat linkages allow for the
periodic exchange of animals between habitat areas, which is essential to maintain adequate
gene pools.
The project site is located within an SRA, which is documented in the City of Carlsbad HMP as
an area that is too small, edge-effected, or isolated to be considered biological Cores or linkage
Biological Resources Technical Letter Report April 30, 2026
Salk Avenue Apartments Project Page 11
areas. No known wildlife corridors or linkage areas are mapped as occurring on or in the
immediate vicinity of the project site. The project site is surrounded by a road to the north,
commercial buildings to the east and south, and a golf course to the west. There are no landscape
features or vegetative cover that would support wildlife movement across the landscape. Thus,
the project site does not serve as a habitat linkage or wildlife corridor.
6.0 IMPACT ANALYSIS
The following discussion examines the impacts to biological resources that may occur as a result
of the proposed project. The determination of impacts is based on both the features of the
proposed project and the biological values of the habitat and sensitivity of plant and wildlife
species potentially affected. Based on the project description in Section 2.0 and architecture data
provided by the project applicant, Michael Baker conducted an impact analysis using GIS
technology.
Impacts to biological resources are assessed using impact significance threshold criteria, which
mirror the policy statement contained in the CEQA, Section 21001(c) of the California Public
Resources Code. The questions below model those included in the checklist of questions listed
in Appendix G of the CEQA guidelines and that are considered to determine if the project would
have significant impacts to biological resources.
6.1 Impacts to Special-Status Species
a ould the project have a substantial adverse effect, either directly or through habitat
modifications, on any species identified as a candidate, sensitive, or special status species in
local or regional plans, policies, or regulations, or by the California Department of Fish and
ildlife or U.S. Fish and ildlife Service
Less Than Significant Impact with Mitigation Incorporated.In general, special-status that are
known to the region were not expected to be observed found during surveys on the project site
due to general lack of suitable habitat. None of the special-status animal species known to the
region have a high potential to occur within the project site due primarily to the isolation of the site
from undeveloped habitat blocks in the region and disturbances associated with the highly
urbanized setting. The site does not support the constituent elements required by many of the
special-status animals known to the region for nesting/breeding, foraging, dispersal, and other life
history requirements.
However, a coastal California gnatcatcher was observed within the northwest corner of the project
site during the 2025 survey of the project study area. It is noted that a coastal California
gnatcatcher observation was also made in 2000/2001 in association with the Fox Miller Project
focused surveys, but this species was not detected during the 2003 focused surveys. Even though
there is no suitable habitat for coastal California gnatcatcher within the project limits of
disturbance, implementation of Mitigation Measure BIO-1 (refer to Section 7.0, Mitigation
Measures, below), would ensure that no indirect effects to coastal California gnatcatcher would
occur.
Biological Resources Technical Letter Report April 30, 2026
Salk Avenue Apartments Project Page 12
No other special-status wildlife species were observed during the 2025 survey and are not
expected to occur on the project site due to a lack of suitable habitat and a review of specific
habitat preferences, known distributions, and elevation ranges. The closest location of another
type of special-status species is documented in the California Natural Diversity Database
(CNDDB), with two occurrences of Crotch’s bumble bee in 2024 noted approximately 2.5 miles
north of the project site at Lake Calavera Preserve. However, no individuals or nests of Crotch’s
bumble bee were observed on or adjacent to the project site during the general biological survey
for the project on January 24, 2025. Because of (1) the presence of nectaring sources (i.e., food
sources) present on and near the project site, (2) the presence of other bumble bees on the
project site during the January 24, 2025 biological survey (a yellow-faced bumble bee), and (3)
two known CNDDB identifications of Crotch’s bumble bee within approximately 2.5 miles of the
project site, there is moderate potential for Crotch’s bumble bee to occur on the project site,
although likely only within the 0.33-acre patch of Diegan coastal sage scrub in the northwest
corner of the project site. This limited area of habitat supports nectaring sources that may be used
by foraging Crotch’s bumble bee and soils that could provide nesting and overwintering habitat.
Although no direct impacts to Crotch’s bumble bee individuals or nests are expected from the
project due to lack of suitable nectaring sources for foraging and lack of nesting habitat, there is
a potential for indirect effects if the species is present in the 0.33-acre patch of Diegan coastal
sage scrub in the northwest corner of the project site. Indirect impacts to Crotch’s bumble bee
could occur from fugitive dust during ground-disturbing construction activities. Such indirect
impacts to Crotch’s bumble bee would be potentially significant. However, implementation of
Mitigation Measure BIO-2 would reduce potential indirect impacts to Crotch’s bumble bee to less
than significant levels.
Several non-listed, sensitive bird species could potentially nest and/or forage over the site,
although the potential is low. These species are relatively common to the region. Construction
activities associated with the project could potentially result in significant impacts to nesting birds
if project activities cause a nest(s) to fail. However, with implementation of Mitigation Measure
BIO-1 (refer to Section 7.0, Mitigation Measures, below), project impacts to nesting birds would
be less than significant.
No special-status plant species were observed during the field survey; however, as discussed in
Section 4.3, Biological Resources, of the Housing Element Update SEIR, thread-leaved brodiaea
has a high potential to occur in the Diegan Coastal Sage Scrub in the northwest corner of the
project site, which would not be impacted by development of the proposed project. The project
site was also subject to focused surveys for the species in 2001 and 2003 associated with the
Fox Miller Project. During the 2003 focused surveys, a total of 19,100 thread-leaved brodiaea
plants were counted on the Fox Miller Property II; however, none of these plants were observed
on the project site. Additionally, the 2002 Fox Miller Project MND concluded that implementation
of the Fox Miller Project could potentially result in significant impacts to thread-leaved brodiaea.
The required mitigation for impacts to thread-leaved brodiaea due to development of the Fox
Miller Property II, which included the project site, was previously conducted under the Fox Miller
Project. The proposed project would not introduce new areas of disturbance or result in a
substantial increase in the severity of the previously identified significant effects to thread-leaved
brodiaea included in the 2002 MND. The anticipated environmental impacts to thread-leaved
Biological Resources Technical Letter Report April 30, 2026
Salk Avenue Apartments Project Page 13
brodiaea were adequately analyzed in the prior environmental analysis, and that impact analysis
did not indicate impact on or from the project site, requiring no additional environmental review.
The project site was graded in 2007, resulting in primarily developed and disturbed vegetation.
Per correspondence with the project applicant, the project site is maintained (mowed) on an
annual basis. The isolated 0.33-acre patch of Diegan Coastal Sage Scrub in the northwest corner
of the project site is located outside the proposed development footprint. Therefore,
implementation of the proposed project would not impact special-status species habitat.
Additionally, the project includes an off-site limits of disturbance area associated with installation
of a sewer line within the existing developed roadway on College Boulevard (Study Area-Off-Site
Sewer Line). This area is fully paved and does not contain natural habitat or vegetation that could
support special-status species. Therefore, construction within this off-site improvement area
would have no impact on candidate, sensitive, or special-status species.
6.2 Impacts to Sensitive Natural Communities
b ould the project have a substantial adverse effect on any riparian habitat or other sensitive
natural community identified in local or regional plans, policies, regulations or by the California
Department of Fish and ildlife or U.S. Fish and ildlife Service
No Impact. The project site supports the following vegetation communities/land cover types:
Diegan Coastal Sage Scrub, Disturbed Habitat, and Urban/Developed. Of these, Diegan Coastal
Sage Scrub is a sensitive vegetation community and is habitat for sensitive species. The Diegan
Coastal Sage Scrub is limited to an isolated 0.33-acre patch in the northwest corner of the project
site. However, the isolated 0.33-acre patch of Diegan coastal sage scrub is located outside the
proposed limits of disturbance. Further, there is no riparian habitat within the project site, off-site
improvement area, or adjacent areas. Therefore, the project would result in no impact on riparian
habitat and other sensitive natural communities.
6.3 Impacts to State or Federal Wetlands
c ould the project have a substantial adverse effect on state or federally protected etlands
including, but not limited to, marsh, vernal pool, coastal, etc. through direct removal, filling,
hydrological interruption, or other means
No Impact. There are no State or Federally protected wetlands on the project site or the off-site
improvement area. Therefore, implementation of the project would result in no impact to State or
Federally protected wetlands.
Biological Resources Technical Letter Report April 30, 2026
Salk Avenue Apartments Project Page 14
6.4 Impacts to Wildlife Movement or Wildlife Corridors
d ould the project interfere substantially ith the movement of any native resident or migratory
fish or ildlife species or ith established native resident or migratory ildlife corridors, or
impede the use of native ildlife nursery sites
No Impact. The project site is surrounded by a road to the north, commercial buildings to the east
and south, and a golf course to the west. The project site is further characterized by open,
exposed areas that lack suitable cover and resources that are typically associated with wildlife
movement areas. There are no landscape features or vegetative cover that would support wildlife
movement or native wildlife nursery sites across the landscape in the project area. Common birds
and mammals might move through the site to forage and during dispersal activities; however, they
would not be expected to use the site as a wildlife corridor, linkage, or specific travel route to and
from nursery sites other important resources
Additionally, the off-site limits of disturbance area (Study Area-Off-Site Sewer Line) is a fully
developed road with no landscape features or vegetative cover that would support wildlife
movement or native wildlife nursery sites. Thus, the project site, off-site improvement area (Study
Area-Off-Site Sewer Line) and immediately adjacent areas do not support wildlife movement or
native wildlife nursery sites. Accordingly, the project would not interfere substantially with the
movement of any native resident or migratory fish or wildlife species or with established native
resident or migratory wildlife corridors, or impede the use of native wildlife nursery sites, and no
impact would occur.
6.5 Conflicts with Local Policies or Ordinances
e ould the project conflict ith any local policies or ordinances protecting biological resources,
such as a tree preservation policy or ordinance
Less Than Significant Impact. There are no regulated trees on the project site or the off-site
improvement area (Study Area-Off-Site Sewer Line) that would be subjected to the provisions of
City of Carlsbad Municipal Code Section 11.12.140, Heritage Trees, and Section 11.12.090,
Permits Required for Tree Removal and Maintenance. These ordinances regulate trees located
on public streets, trees with notable historic interest, and trees of unusual species or size. There
are two non-native, invasive fig trees within the proposed project footprint that would be removed;
however, neither fig tree is in the public right-of-way, of notable historic interest, or of an unusual
species or size, pursuant to Carlsbad Municipal Code Section 11.12.140. Therefore, these fig
trees are not considered protected trees. No trees would be impacted by the construction of the
off-site sewer line in College Boulevard. Thus, the project would not conflict with any local policies
or ordinances protecting biological resources, and impacts would be less than significant.
Biological Resources Technical Letter Report April 30, 2026
Salk Avenue Apartments Project Page 15
6.6 Conflicts with Adopted Habitat Conservation Plan
f ould the project conflict ith the provisions of an adopted Habitat Conservation Plan, Natural
Community Conservation Plan, or other approved local, regional, or state habitat conservation
plan
Less Than Significant Impact.As mentioned in Section 3.2 above, the project site and the off-
site improvement area (Study Area – Off-Site Sewer Line) are within the boundaries of the City of
Carlsbad HMP and is located in SRA 1. However, the project site is not within a HMP Hardline
Conservation Area or HMP Proposed Hardline Conservation Area, which is identified for
conservation. The northernmost approximately 40 feet of the existing driveway that provides
access to the project site and would be improved as part of the proposed project and serve as
egress/ingress for the project. This area is within 100 feet of a HMP Proposed Hardline
Conservation Area (Attachment A, Figure 6,Plans and Policies). The Proposed Hardline
Conservation Areas are specific zones within the HMP that are designated for conservation. The
HMP Adjacency Standards are designed to prevent negative effects to urban wildlife preserve
system and include fire management; erosion control; landscaping restrictions; fencing, signs,
and lighting; and predator and exotic species control (pursuant to Section F.3 of the HMP). Even
though the proposed improvements associated with the proposed project are not within a
designated HMP Proposed Hardline Conservation Area, the project would be required to adhere
to the HMP Adjacency Standards, as part of the City’s conditions of approval for the project.
Proposed improvements associated with the northernmost appropriately 40 feet of the existing
driveway would be subject to applicable fuel modification zone requirements for fire management;
the City Fire Department has reviewed and preliminary approved the proposed fuel modification
zones for the project. Additionally, it is noted that the fuel modification area required for the project
would not encroach into a HMP Proposed Hardline Conservation Area. Construction of the project
would include implementation of standard construction best management practices (BMPs), as
well as implementation of a project-specific Storm Water Pollution Prevention Plan (SWPPP),
which would minimize erosion during construction.
The project landscape plan would ensure project site slopes are stabilized after construction is
completed. Additionally, the project landscape plan would be reviewed by the City Planning
Division prior to issuance of a grading permit to ensure that no non-native, invasive plant species
are proposed. Drought-tolerant plant species would also be used on-site to minimize irrigation
runoff potential. The project would limit the amount of fertilization of ornamental plants on the
project site that could drain towards the Proposed Hardline area to the north of Salk Avenue.
The project would not include fencing within the HMP Preserve, and as such, the project would
not impede wildlife movement within the Preserve. No signs prohibiting entrance into the preserve
would be required on the project site, as Salk Avenue is located in between the project site and
the closest HMP Proposed Hardline Conservation Area. However, to minimize any potential
indirect impact, future project residences would receive educational brochures regarding the
nearby HMP Preserve to deter human and pet access into the Preserve. Streetlighting currently
Biological Resources Technical Letter Report April 30, 2026
Salk Avenue Apartments Project Page 16
exists along Salk Avenue. The project would include security lighting along the driveway; however,
proposed lighting would be low pressure sodium, directed downward, and shielded away from the
HMP Proposed Hardline Conservation Area.
Accordingly, the proposed project would not conflict with the provisions of the Carlsbad HMP or
Adjacency Standards, and impacts would be less than significant.
7.0 MITIGATION MEASURES
With implementation of Mitigation Measure BIO-1 and Mitigation Measure BIO-2, project
impacts to biological resources would be less than significant. No other mitigation is required.
Mitigation Measure BIO-1 (Pre-Construction Nesting Bird Surveys, Avoidance, and
Notification).If construction activities are initiated during the bird nesting season (February 1–
August 31) involving removal of vegetation or other nesting bird habitat, including abandoned
structures and other man-made features, a pre-construction nesting bird survey shall be
conducted no more than three days prior to initiation of ground disturbance and vegetation
removal activities. The nesting bird pre-construction survey shall be conducted on foot and shall
include a 300-foot survey buffer around the construction site. The survey shall be conducted by a
biologist familiar with the identification of avian species known to occur in southern California
coastal communities (i.e., qualified biologist). If active nests are found, an avoidance buffer shall
be determined by a qualified biologist in coordination with the City. The avoidance buffer width
will depend upon the species, the proposed work activity, and existing disturbances associated
with land uses outside of the site, which shall be demarcated by the biologist with bright orange
construction fencing, flagging, construction lathe, or other means to demarcate the boundary. All
construction personnel shall be notified as to the existence of the buffer zone and to avoid entering
the buffer zone during the nesting season. No ground-disturbing activities shall occur within the
buffer until the biologist has confirmed that breeding/nesting is completed, and the young have
fledged the nest. Encroachment into the buffer shall occur only at the discretion of the qualified
biologist on the basis that the encroachment will not be detrimental to an active nest. A report
summarizing the pre-construction survey(s) shall be prepared by a qualified biologist and shall be
submitted to the City prior to the commencement of construction activities.
If an active coastal California gnatcatcher nest is found during pre-construction surveys, a
minimum 500-foot no-disturbance buffer shall be established around the nest. The buffer shall be
clearly marked (e.g., with fencing or flagging) and maintained until a qualified biologist confirms
that the young have fledged, the nest is no longer active, or that construction noise levels can be
maintained below 60 dBA Leq at the nest site with a smaller buffer. In no circumstances shall a
buffer of less than 100 feet be used even with noise attenuation measures. Any reduction in the
500-foot buffer must be supported by site-specific analysis by the qualified biologist and approved
by the City in consultation with the US Fish and Wildlife Service.
Biological Resources Technical Letter Report April 30, 2026
Salk Avenue Apartments Project Page 17
Note: To mitigate the potential impact to California gnatcatcher or other nesting birds, this
mitigation measure shall be applied to land use and activities occurring at the project site. No Pre-
Construction Nesting Bird Surveys, Avoidance, and Notification mitigation is required to
implement the Study Area-Off-Site Sewer Line portion of the project.
Mitigation Measure BIO-2 (Crotch’s Bumble Bee [CBB] Avoidance and Clearance Survey).
x Focused Survey. Three on-site surveys for Crotch’s bumble bee (CBB) shall be conducted
prior to initiation of ground disturbing project activities to identify if the CBB is present
within the project site. This survey shall be conducted simultaneously with the blooming
period of the species’ recognized food plants, when the CBB is most active. Each survey
shall be spaced at least 2 weeks but no more than 4 weeks apart, corresponding with the
Colony Active Season for Bombus species (April–August). The surveying biologist shall
be familiar with the primary identification characteristics of the CBB and be proficient in
the methodology produced by the Xerces Society. The qualified biologist shall utilize a
telephoto lens or a sufficiently long macro lens to obtain high-quality photos of bumble
bees, sufficient for species identification, without having to capture and potentially harm
the bumble bees.
x Absence of Species. If no CBB are detected during the focused surveys, no further
measures shall be necessary.
x Presence of Species. If CBB are detected, then site-specific measures shall be
implemented to avoid take unless an Incidental Take Permit (ITP) for the species is
obtained from CDFW. Such avoidance measures shall include:
o If vegetation removal activities and initial ground-disturbing activities (i.e., clearing,
grubbing, and initial site grading) occur during the Queen and Gyne Flight Period
and Colony Active Period for these species (February–October), a qualified
biologist shall conduct daily biological monitoring. During monitoring, the qualified
biologist shall inspect suitable habitat for CBB activity within the day’s work area.
If the species is not detected, then project activities can proceed without further
biological monitoring that day.
o If the CBB is detected using nectar sources, then a no-disturbance buffer of at least
25 feet around the individual(s) shall be established, and the individual(s) shall be
monitored by a biological monitor until the CBB are confirmed to have left the area
on their own.
o If a CBB nest is detected where ground disturbance is proposed to occur, then a
minimum 30-foot no-disturbance buffer (with a buffer of up to 60 feet if disturbance
is substantial) around the nest shall be established. This buffer shall remain in
place until the nest senesces, which would occur after no nest activity observations
for three sequential days. The qualified biologist shall discuss the buffer with the
Biological Resources Technical Letter Report April 30, 2026
Salk Avenue Apartments Project Page 18
contractor to ensure that work areas, including ingress and egress routes, avoid
the CBB.
o If the project cannot avoid the established no-disturbance buffer(s) identified
above, the project applicant shall halt work within the buffer area and shall consult
with CDFW on appropriate avoidance actions and obtain an Incidental Take Permit
if necessary.
Note: To mitigate the potential impact to Crotch’s Bumble Bee (CBB), this mitigation measure
shall be applied to land use and activities occurring at the project site. No CBB Avoidance and
Clearance Survey mitigation is required to implement the Study Area-Off-Site Sewer Line
portion of the project.
8.0 CONCLUSIONS
With implementation of Mitigation Measure BIO-1 and Mitigation Measure BIO-2, the proposed
Salk Avenue Apartments Project’s impacts to biological resources would to less than significant.
Please do not hesitate to contact Marisa Flores at (858) 614-5052 or
marisa.flores@mbakerintl.com should you have any questions or require further information.
Sincerely,
Marisa Flores
Associate
Natural Resources Technical Manager
Attachments
A. Figures
B. Site Photographs
C. Species Compendium
D. Special-Status Species Potential to Occur Tables
Marisa Flores
YŻ÷ŀµ0ďƒeŀ
Biological Resources Technical Letter Report April 30, 2026
Salk Avenue Apartments Project Page 19
REFERENCES
Carlsbad, City of .1999. Habitat Management Plan for Natural Communities in the City of
Carlsbad.
CDFW (California Department of Fish and Wildlife). 2025. Natural Communities List Arranged
Alphabetically by Life Form. January 2025. Accessed January 22, 2025.
https://wildlife.ca.gov/Data/VegCAMP/Natural-Communities.
Chesser, R. T., S. M. Billerman, K. J. Burns, C. Cicero, J. L. Dunn, B. E. Hernández-Baños, R. A.
Jiménez, A. W. Kratter, N. A. Mason, P. C. Rasmussen, J. V. Remsen, Jr., and K. Winker.
2023. Check-list of North American Birds (online). American Ornithological Society.
https://checklist.americanornithology.org/taxa/.
CNDDB (California Natural Diversity Database). 2025. RareFind 5 [Internet]. California
Department of Fish and Wildlife [January 22, 2025].
CNDDB. 2025. Special Animals List. California Department of Fish and Wildlife. Sacramento, CA.
CNDDB. 2025. Special Vascular Plants, Bryophytes, and Lichens List. California Department of
Fish and Wildlife. Sacramento, CA.
CNDDB. 2025. State and Federally Listed Endangered and Threatened Animals of California.
California Department of Fish and Wildlife. Sacramento, CA.
CNDDB. 2025. State and Federally Listed Endangered, Threatened, and Rare Plants of
California. California Department of Fish and Wildlife. Sacramento, CA.
CNPS (California Native Plant Society), Rare Plant Program. 2025. Rare Plant Inventory (online
edition, v9.5). Website https://www.rareplants.cnps.org [accessed 22 January 2025].
Crother, B.I., ed. 2017. Scientific and Standard English Names of Amphibians and Reptiles of
North America North of Mexico, with Comments Regarding Confidence in Our
Understanding. Herpetological Circular, no. 43. 8th ed. Shoreview, Minnesota: Society for
the Study of Amphibians and Reptiles. https://ssarherps.org/wp-
content/uploads/2017/10/8th-Ed-2017-Scientific-and-Standard-English-Names.pdf.
Google (Google, Inc.). 2025. Google Earth Pro, version 7.3.6.9345. Historical aerial imagery from
1985 to 2025.
HistoricAerials.com. 2025. Historic aerial image from 1962. http://www.historicaerials.com.
NABA (North American Butterfly Association). 2025.Checklist of North American Butterflies,
Butterflies Occurring North of Mexico, Edition ..https://naba.org/butterfly-names-
checklist/.
Oberbauer, Thomas, Meghan Kelly, and Jeremy Buegge. March 2008. Draft Vegetation
Communities of San Diego County. Based on “Preliminary Descriptions of the Terrestrial
Natural Communities of California,” Robert F. Holland, Ph.D., October 1986.
Biological Resources Technical Letter Report April 30, 2026
Salk Avenue Apartments Project Page 20
RECON. 2001. Revised Biological Technical Report for the Fox Property, Carlsbad, California.
April.
RECON. 2004. Biological Resources Survey Update and Project Impact Revisions for Fox-Miller
Property, Carlsbad, California.
Reid, F.A. 2006. A Field Guide to Mammals of North America, Fourth Edition. Houghton Mifflin
Company, New York, New York.
Sibley, D.A. 2014. The Sibley Guide to Birds, Second Edition. Alfred A. Knopf, Inc., New York,
New York.
Stebbins, R.C. 2003. A Field Guide to estern Reptiles and Amphibians, Third Edition. Houghton
Mifflin Company, New York, New York.
USDA NRCS (U.S. Department of Agriculture, Natural Resources Conservation Service). 2025.
Web Soil Survey. https://websoilsurvey.nrcs.usda.gov/app/WebSoilSurvey.aspx
[accessed April 5, 2024].
USFWS. 2025. Critical Habitat for Threatened & Endangered Species.
https://fws.maps.arcgis.com/home/webmap/viewer.html?webmap=9d8de5e265ad4fe098
93cf75b8dbfb77 [accessed January 22, 2025].
USFWS (U.S. Fish and Wildlife Service). 2025. Information for Planning and Consultation (IPaC).
https://ipac.ecosphere.fws.gov/location/index [accessed January 22, 2025].
USFWS. 2025. National Wetlands Inventory. Website
https://fwsprimary.wim.usgs.gov/wetlands/apps/wetlands-mapper/[accessed January 22,
2025].
Wilson, D.E., and D.M. Reeder, eds. 2005. Mammal Species of the orld A Taxonomic and
Geographic Reference. 3rd ed. Online version. Baltimore, Maryland: Johns Hopkins
University Press. Accessed August 17, 2010. http://www.bucknell.edu/msw3/.
Salk Avenue Apartments Project
Comment Letters and Responses to Comments
SCH No. 2026030432
May 2026
Lead Agency Prepared by
City of Carlsbad
Community Development Department
1635 Faraday Avenue
Carlsbad, CA 92008
5050 Avenida Encinas, Suite 260
Carlsbad, CA 92008
JN 205484
Comment Letters and Responses to Comments
Salk Avenue Apartments Project Page i
Table of Contents
1.0 Introduction....................................................................................................................... 1-1
2.0 Comment Letters Received and Responses to Comments.......................................... 2-1
Letter 1 ................................................................................................................................... 2-2
Letter 2 ................................................................................................................................. 2-26
Comment Letters and Responses to Comments
Salk Avenue Apartments Project Page 1-1
1.0 INTRODUCTION
The City of Carlsbad (City) prepared a Focused Initial Study/Mitigated Negative Declaration
(IS/MND) for the Salk Avenue Apartments Project (proposed project). Pursuant to Sections 15072
and 15073 of the California Environmental Quality Act (CEQA) Guidelines, the IS/MND and Notice
of Intent (NOI) to adopt the MND were circulated for a 31-day public review period that began on
February 25, 2026, and ended on March 27, 2026.
The NOI was filed with the County of San Diego County Clerk on February 25, 2026. Additionally,
the IS/MND and NOI were posted on the City’s website throughout the duration of the public
review period and hard copies were made available for public review at the City’s Planning
Division Counter.
A total of two comment letters were received during the public review period. The letters are
included herein in their entirety and are followed by the City’s written responses. Refer to
Section 2.0, Comment Letters Received and Responses to Comments.
Pursuant to Section 15074(b) of the CEQA Guidelines, the lead agency (City) is required to
consider the MND along with any comments received during the public review period. While
written responses to comments submitted on MNDs are not required, responses are provided
herein to each written comment received for the record, with particular regard for environmental
concerns related to CEQA issues.
Based on the whole of the record, the City finds that the comments received do not raise any new
potentially significant impacts, do not identify an increase to the severity of any impacts disclosed
in the IS/MND, and do not require substantial revision of the IS/MND. Pursuant to Section 15073.5
of the CEQA Guidelines, recirculation of the IS/MND is not required. Further, preparation of an
Environmental Impact Report is not required as all potentially significant environmental impacts
that may result from the proposed project have been mitigated to less than significant levels.
Comment Letters and Responses to Comments
Salk Avenue Apartments Project Page 2-1
2.0 COMMENT LETTERS RECEIVED AND RESPONSES TO
COMMENTS
Comment Letters and Responses to Comments
Salk Avenue Apartments Project
Comment Letters and Responses to Comments
Salk Avenue Apartments Project
Re: Comment on Focused Initial Study/Mitigated Negative Declaration for the Salk
Avenue Apartments Project (SCH No. 2026030432); AB 130/SB 131 CEQA Exemption
Evaluation (Appendices A and B)
Dear Mr. Van Leeuwen:
I am submitting the following comments on the Focused Initial Study/Mitigated Negative
Declaration (“Focused IS/MND”) and the associated AB 130 Housing Development Project
CEQA Exemption Evaluation Checklist (Appendix A) and SB 131 Exclusions of Certain Types
of Housing Development Projects CEQA Exemption Evaluation (Appendix B) prepared for
the Salk Avenue Apartments Project (“Project”) in the City of Carlsbad (“City”). The Project
proposes 397 multi-family residential dwelling units in a Ʊve-story building on an
approximately 9.78-acre site located on Salk Avenue within the Fenton Carlsbad Center
SpeciƱc Plan area.
The Project claims entitlement to a 35 percent density bonus under Government Code
Section 65915 and relies on the SB 131 near-miss pathway under Public Resources Code
Section 21080.1 to limit CEQA review to biological resources, asserting that habitat for
protected species under Government Code Section 65913.4(a)(6)(J) is the sole
disqualifying condition preventing full AB 130 exemption. Under CEQA Guidelines Section
15064(f)(2) and Public Resources Code Section 21082.2, an Environmental Impact Report
is required whenever substantial evidence supports a fair argument that a project may have
a signiƱcant eƯect on the environment, regardless of whether other substantial evidence
supports a contrary conclusion. (No Oil, Inc. v. City of Los Angeles (1974) 13 Cal.3d 68, 75.)
As detailed below, the administrative record raises two independent grounds for challenge:
(1) the Project does not qualify for SB 131 near-miss treatment because it fails the AB 130
statutory exemption due to multiple disqualifying conditions, not a single condition; and (2)
even accepting the City’s single-condition framework arguendo, the Focused IS/MND’s
biological resources analysis is substantively inadequate because it fails to analyze well-
documented impact pathways identiƱed by the U.S. Fish and Wildlife Service as threats to
the survival and recovery of species conƱrmed on-site. Each ground independently
requires preparation of an Environmental Impact Report.
I. THE SB 131 NEAR-MISS PATHWAY IS UNAVAILABLE BECAUSE THE RECORD
IDENTIFIES MULTIPLE DISQUALIFYING CONDITIONS
The Project’s entire CEQA compliance strategy depends on a single premise: that habitat
for protected species under Section 65913.4(a)(6)(J) is the only condition disqualifying the
Project from the AB 130 statutory exemption. PRC Section 21080.1(4)(B) expressly provides
that SB 131’s streamlined review does not apply to “[a] proposed housing development
1-1
Pa e 2-2
Comment Letters and Responses to Comments
Salk Avenue Apartments Project
project that is ineligible for the statutory exemption or categorical exemption due to two or
more conditions.” The administrative record identiƱes multiple disqualifying conditions
through two independent analytical pathways.
A. Three Species Under Three Regulatory Frameworks Constitute Multiple Conditions
Under Section 21080.66(a)(6)(J)
Section 21080.66(a)(6)(J) disqualiƱes sites containing “[h]abitat for protected species
identiƱed as candidate, sensitive, or species of special status by state or federal agencies,
fully protected species, or species protected by the federal Endangered Species Act of
1973 . . . , the California Endangered Species Act . . . , or the Native Plant Protection Act.”
The statute does not treat these as synonyms. It enumerates distinct legal categories with
distinct regulatory consequences.
The Project’s own biological consultant identiƱes habitat or conƱrmed presence for three
distinct species operating under at least three separate regulatory frameworks:
Coastal California gnatcatcher (Polioptila californica californica): Federally listed as
threatened under the ESA; California Species of Special Concern. ConƱrmed present on-
site during the January 24, 2025 biological survey. The site includes USFWS-designated
critical habitat. This species has its own recovery plan, recovery implementation strategy,
and critical habitat designation rule, all administered by the Carlsbad Fish and Wildlife
OƯice, the same USFWS oƯice with jurisdiction over this Project site. The gnatcatcher
triggers federal Section 7 consultation requirements.
Crotch’s bumble bee (Bombus crotchii): State candidate endangered under CESA, with
protections equivalent to a fully listed species under Fish and Game Code Section 2085.
The Focused IS/MND acknowledges “moderate potential” for occurrence and identiƱes
CDFW as a trustee agency that may need to issue an Incidental Take Permit, a separate
discretionary action under an entirely diƯerent statutory framework than the ESA.
Thread-leaved brodiaea (Brodiaea Ʊlifolia): Federally threatened under the ESA; state
endangered under CESA; California Rare Plant Rank 1B.1; additionally protected under the
Native Plant Protection Act. USFWS has designated critical habitat on the Project site. This
single species is subject to protection under three separate statutory frameworks - the
ESA, CESA, and NPPA - each independently referenced in Section 21080.66(a)(6)(J).
PRC Section 21080.1 deƱnes “condition” as “a physical or regulatory feature of the project
or its setting or eƯect on the environment caused by the project.” Each of these three
species involves distinct physical and regulatory features. The gnatcatcher is an obligate
coastal sage scrub species with speciƱc territory requirements, noise sensitivity
thresholds, and vulnerabilit to redation and brood arasitism. Crotch’s bumble bee is a
1 1
(cont.)
Pa e 2-3
Comment Letters and Responses to Comments
Salk Avenue Apartments Project
ground-nesting pollinator with entirely diƯerent habitat use patterns requiring nectaring
sources and speciƱc soil conditions for nesting and overwintering, triggering a separate
CESA regulatory pathway. Thread-leaved brodiaea is an edaphic specialist dependent on
speciƱc clay soil moisture regimes, with diƯerent sensitivity to altered hydrology; a distinct
impact pathway not shared with the other two species.
The presence of three biologically distinct species, three separate listing statutes, three
independent regulatory pathways, and three diƯerent impact mechanisms constitutes
multiple “physical or regulatory feature[s]” of the Project’s setting. The City’s conƲation of
these into a single “condition” is inconsistent with the statutory text.
B. The HMP Special Resource Area Designation Creates an Independent Second
Disqualifying Condition
The Project’s own biological technical report states that the site is “not within a . . . Special
Resource Area.” In the same section, the report quotes the Carlsbad Habitat Management
Plan description of Special Resource Area 1 as lying “between El Camino Real, Faraday
Avenue, and College Boulevard within Zone 5.” The Project site is located south of Salk
Avenue, west of El Camino Real, east of College Boulevard, and north of Faraday Avenue,
within the geographic boundaries the HMP describes for SRA 1. The document quotes the
description and then denies the site falls within it, without explanation or reconciliation.
The HMP describes SRA 1 as supporting “a major population of a Narrow Endemic plant
species (Brodiaea Ʊlifolia)” and states that “conservation of Narrow Endemic plant
populations within the SRA is considered important for species conservation.” This
language, “identiƱed” in an adopted NCCP as “important for species conservation” maps
directly onto the disqualifying condition in Section 65913.4(a)(6)(I): lands identiƱed for
conservation in an adopted natural community conservation plan.
This reading is reinforced by SB 158, signed October 11, 2025, which revised the deƱnition
of “natural and protected lands” in PRC Section 21067.5 to expressly include lands
identiƱed for conservation in an adopted NCCP. The Carlsbad HMP is an NCCP. The SRA
designation, which the HMP itself describes as important for species conservation,
constitutes identiƱcation for conservation under the post-SB 158 framework.
If SRA 1 constitutes land identiƱed for conservation under Section 65913.4(a)(6)(I), the
Project has at minimum two disqualifying conditions: (a)(6)(J) for protected species habitat
and (a)(6)(I) for NCCP conservation lands. Two conditions defeat the near-miss pathway
under Section 21080.1(4)(B). The consequence is the collapse of the focused IS/MND
framework, requiring full CEQA review of all environmental topics.
1 1
(cont.)
1-2
Pa e 2-4
Comment Letters and Responses to Comments
Salk Avenue Apartments Project
C. The Two Analytical Pathways Are Independent and Cumulative
The multi-species argument (Section I.A) and the SRA 1 argument (Section I.B) are
independent. Either alone establishes multiple disqualifying conditions. Together, they
demonstrate that the Project’s claimed single condition is, at minimum, two conditions
and potentially several more. The City must prevail on both arguments to sustain the near-
miss pathway. If either succeeds, full CEQA review is required for all environmental topics
including the disciplines the SB 131 framework currently excludes: air quality, traƯic, noise,
hydrology, geology, aesthetics, greenhouse gas emissions, and land use.
II. EVEN IF THE NEAR-MISS PATHWAY IS AVAILABLE, THE FOCUSED BIOLOGICAL
ANALYSIS IS INDEPENDENTLY INADEQUATE
Independent of whether the Project satisƱes the statutory criteria for the SB 131 near-miss
pathway, the IS/MND contains signiƱcant analytical deƱciencies that independently
require preparation of an EIR. Under the SB 131 framework, the biological analysis is the
only environmental analysis required. The adequacy of that analysis is therefore the central
question for the entire environmental document. The deƱciencies identiƱed below
demonstrate that the analysis does not satisfy CEQA’s requirements.
A. Deferred Baseline Investigations for Listed and Candidate Species
The IS/MND adopts less-than-signiƱcant Ʊndings for two listed or candidate species
without Ʊrst establishing whether those species are present on the project site. The
signiƱcance determinations are contingent on information that does not yet exist in the
record.
Crotch’s bumble bee.MM BIO-2 defers the presence/absence determination to
preconstruction focused surveys conducted after project approval. If the species is
detected, avoidance buƯers are required; if avoidance is not feasible, an ITP must be
obtained from CDFW. The IS/MND concludes less than signiƱcant with mitigation without
knowing whether the species is present, what the extent of use is, or whether avoidance is
feasible. The focused surveys required by MM BIO-2 are the analysis necessary to
determine signiƱcance and should have been conducted during CEQA review. (Sundstrom
v. County of Mendocino (1988) 202 Cal.App.3d 296.)
The deferral is compounded by a facial inconsistency. The biological technical report states
that the 0.33-acre CSS patch “supports nectaring sources that may be used by foraging
Crotch’s bumble bee and soils that could provide nesting and overwintering habitat.” The
IS/MND then states that “no direct impacts to CBB individuals or nests are expected from
the project due to lack of suitable nectaring sources for foraging and lack of nesting
habitat.” The document identiƱes suitable habitat as the basis for a moderate occurrence
1-3
1-4
Pa e 2-5
Comment Letters and Responses to Comments
Salk Avenue Apartments Project
potential and then denies the existence of that same habitat to support a less-than-
signiƱcant determination. This internal contradiction undermines the reliability of the
signiƱcance conclusion.
Thread-leaved brodiaea
The IS/MND concludes no impact based on focused surveys conducted in 2001 and 2003 -
twenty-two to twenty-four years before the current document - and a January 2025 survey
conducted outside the species’ March-through-June blooming period. Thread-leaved
brodiaea is a geophyte reliably detectable only during bloom. The 0.33-acre CSS patch
overlapping USFWS-designated critical habitat was not graded in 2007 and remains intact.
The document’s own Attachment D assigns “Moderate” potential. No current-year focused
botanical survey during the blooming period has been conducted. The CDFW 2018
Protocols for Surveying and Evaluating Impacts to Special Status Native Plant Populations
require Ʋoristic surveys timed to the blooming period of target species.
Foundational baseline deƱciency
Both species-speciƱc failures are symptomatic of a broader problem. The entire biological
resources analysis rests on a single two-hour habitat assessment conducted on January
24, 2025, from 8:15 a.m. to 10:15 a.m. January is outside the primary blooming period for
most special-status plant species in coastal San Diego County, outside the breeding
season for gnatcatcher, and outside the colony active season for Crotch’s bumble bee. The
document uses this single winter visit to inform the dismissal of 64 special-status wildlife
species and 67 of 68 special-status plant species as “not expected to occur.” Where the SB
131 framework concentrates the entire CEQA document on biological resources, the
adequacy of the biological baseline is paramount.
B. ConƱrmed Federally Threatened Species: Inadequate Analysis and Unenforceable
Mitigation
A coastal California gnatcatcher was conƱrmed present on the project site during the
January 2025 survey. The IS/MND’s treatment of this species is deƱcient in four
independent respects.
1. No Protocol Survey
No protocol-level focused survey was conducted. The USFWS Coastal California
Gnatcatcher Presence/Absence Survey Protocol requires a minimum of six breeding-
season visits between March 15 and June 30 with taped vocalization playback. Without
protocol data on territory boundaries, pair status, and nesting locations, the document
cannot evaluate whether the 100-foot buƯer between the CSS patch and the development
1-4
(cont.)
1-5
1-6
1-7
Pa e 2-6
Comment Letters and Responses to Comments
Salk Avenue Apartments Project
footprint is adequate. USFWS guidance recommends a minimum 500-foot buƯer from
active nests or demonstration that construction noise will not exceed 60 dB(A) Leq at the
nest. The IS/MND evaluates the project against neither standard.
2. Unenforceable Mitigation
MM BIO-1 defers the determination of avoidance buƯer width to the discretion of a
qualiƱed biologist “in coordination with the City” without establishing minimum buƯer
distances or noise thresholds. While discretionary buƯer determination is accepted
practice for common nesting birds, it is insuƯicient for a federally threatened species with
established noise sensitivity thresholds. A mitigation measure that defers the critical
protective determination for a federally listed species to post-approval discretion without
minimum enforceable criteria does not constitute enforceable mitigation under CEQA
Guidelines Section 15126.4.
3. Omission of Indirect Impact Analysis
The IS/MND concludes “No Impact” to sensitive natural communities under threshold (b)
based solely on avoidance of direct impacts to the 0.33-acre CSS patch. This
determination fails to analyze indirect impacts from a 397-unit, Ʊve-story residential
complex approximately 100 feet away. The document’s own analysis under threshold (f)
acknowledges the need for HMP Adjacency Standards to address lighting, erosion, invasive
species, and predator control - the same categories of indirect eƯects that must be
analyzed under threshold (b). The document cannot simultaneously acknowledge indirect
eƯects under one threshold and deny them under another.
4. Failure to Address Federal Recovery Framework
The IS/MND’s indirect impact analysis and mitigation measures are inconsistent with the
federal recovery planning framework for the species conƱrmed on-site. The USFWS
completed the Recovery Implementation Strategy for the Coastal California Gnatcatcher in
July 2025, prepared by the same Carlsbad Fish and Wildlife OƯice with jurisdiction over the
Project site. The USFWS also published the Draft Recovery Plan for the species in 2025.
These documents identify speciƱc threats and recovery priorities that the IS/MND fails to
address:
Predation. The USFWS critical habitat designation rule (68 Fed. Reg. 20228, April 24, 2003)
identiƱes predation as the most common cause of nest failure, accounting for 30 to 60
percent of nest failures in some areas, and speciƱcally identiƱes domestic or feral cat as a
recognized predator of gnatcatcher eggs and nestlings. (Citing Atwood 1990; Braden et al.
1997; Grishaver et al. 1998.) The 1993 listing rule recognized the “synergistic eƯects” of
redation in combination with habitat loss, fra mentation, and cowbird arasitism.
1-7
(cont.)
1-8
1-9
1 10
Pa e 2-7
Comment Letters and Responses to Comments
Salk Avenue Apartments Project
Gnatcatchers nest at approximately three feet above ground in coastal sage scrub, well
within reach of domestic cats. The Project will introduce potentially hundreds of domestic
cats within 100 feet of conƱrmed gnatcatcher habitat. The IS/MND’s sole response is
“educational brochures” to future residents, characterized as an HMP adjacency standard
rather than analyzed as a species impact. Educational brochures are not an enforceable
mitigation measure and would not satisfy requirements under ESA Section 7 or Section 10.
Brown-headed cowbird brood parasitism. The Focused IS/MND contains no analysis of
cowbird brood parasitism despite the fact that cowbird parasitism was identiƱed in the
1993 listing rule as a contributing threat. The July 2025 Recovery Implementation Strategy
makes cowbird control a Priority 3 recovery action (Action 7), including monitoring
occupied areas for cowbird presence and trapping where necessary. A 397-unit residential
complex will generate food subsidies - trash, pet food, bird feeders, landscaping with seed-
producing ornamentals - that attract cowbirds into adjacent habitat. The complete
absence of cowbird analysis is a signiƱcant deƱciency.
Habitat connectivity and fragmentation. The IS/MND makes a “No Impact” Ʊnding on
wildlife movement, asserting that the site does not support wildlife corridors. This Ʊnding is
directly contradicted by the federal recovery framework. The Draft Recovery Plan states
that gnatcatchers require “connected habitat patches of adequate area and quality” for
population viability. The Recovery Implementation Strategy identiƱes restoring areas to
“enhance connectivity of areas occupied by coastal California gnatcatcher” as a Priority 2
action (Activity 4-6), noting this is “particularly important where open areas may be
fragmented by development.” Activity 4-7 speciƱcally targets the gnatcatcher corridor
identiƱed in the MHCP, the conservation planning framework under which Carlsbad’s HMP
operates. The USFWS 2024 Ʊve-year status review notes the gnatcatcher “is likely to be
sensitive to further increases in fragmentation and isolation of habitat within the northern
portion of its range.” The 0.33-acre CSS patch with a conƱrmed gnatcatcher is likely
functioning as stepping-stone habitat within the broader HMP preserve network. A Ʊve-
story building with perimeter retaining walls will permanently sever any connectivity
function.
ArtiƱcial lighting. The IS/MND addresses lighting only as an HMP adjacency design
standard (low-pressure sodium, directed downward, shielded). It entirely ignores the
aggregate lighting from a Ʊve-story, 397-unit residential building with windows, balconies,
common areas, a swimming pool, a Ʊve-level parking structure with rooftop parking, and
27,000 square feet of outdoor open space. The building itself is a massive permanent light
source that will alter the light environment of adjacent CSS habitat, aƯecting avian
1 10
(cont.)
1 11
Pa e 2-8
Comment Letters and Responses to Comments
Salk Avenue Apartments Project
behavior, predator-prey dynamics, and insect foraging patterns relevant to both
gnatcatcher prey availability and bumble bee foraging.
Invasive species. The Recovery Implementation Strategy identiƱes control of nonnative
vegetation as a Priority 2 recovery action (Action 5). The IS/MND addresses invasive species
solely through a landscape plan review commitment. It does not analyze the invasive
species introduction pathway from a 397-unit development: irrigation overspray, garden
escapees, ornamental seed dispersal, and nutrient inputs via fertilizer runoƯ. These are
standard impact pathways at the urban-wildland interface.
Altered hydrology and thread-leaved brodiaea critical habitat. The Project will convert
approximately 9.78 acres to largely impervious surface, including a 416,152-square-foot
building and 107,300-square-foot parking structure. Thread-leaved brodiaea is an edaphic
specialist dependent on speciƱc soil moisture conditions in clay soils. USFWS designated
critical habitat on-site because the physical and biological features essential for the
species’ conservation are present. The IS/MND contains no analysis of whether altered
drainage patterns, inƱltration rates, or soil moisture regimes from the Project will aƯect
designated critical habitat 100 feet away. The stormwater discussion is limited to
construction-phase erosion BMPs.
C. Internal Inconsistencies Undermine SigniƱcance Determinations
The IS/MND contains internal inconsistencies where the document simultaneously
identiƱes and denies the existence of habitat conditions.
As discussed above, the Crotch’s bumble bee habitat characterization is facially
contradictory: suitable habitat is identiƱed as the basis for moderate occurrence potential
and then denied to support a less-than-signiƱcant determination.
The SRA 1 geographic inconsistency is similarly irreconcilable: the report quotes an HMP
description that places the site within SRA 1 and then denies the site is within an SRA. If the
site is within SRA 1, the HMP consistency analysis must address SRA-speciƱc conservation
objectives, including the protection of narrow endemic plant populations—speciƱcally
thread-leaved brodiaea.
D. The 0.33-Acre CSS Patch: Convergence of Analytical DeƱciencies
The deƱciencies identiƱed above converge on a single feature: the 0.33-acre patch of
Diegan Coastal Sage Scrub in the northwest corner of the site. This patch was not graded in
2007 and remains intact. It overlaps USFWS-designated critical habitat for thread-leaved
brodiaea. It falls within the geographic boundaries described for HMP Special Resource
Area 1. A coastal California gnatcatcher was conƱrmed present. The biological technical
1 11
(cont.)
1 12
1 13
1 14
1 15
1 16
Pa e 2-9
Comment Letters and Responses to Comments
Salk Avenue Apartments Project
report identiƱes it as supporting nectaring sources and soils suitable for Crotch’s bumble
bee. The HMP describes SRA 1 as designated speciƱcally to protect the narrow endemic
plant species that this critical habitat was designated to conserve.
The document’s treatment of this feature exhibits the full range of analytical deƱciencies:
baseline characterization based on a single out-of-season survey and decades-old
focused studies; no protocol survey for a conƱrmed federally listed bird; a signiƱcance
determination for a candidate species that contradicts the document’s own habitat
characterization; a “No Impact” Ʊnding for indirect eƯects to a sensitive natural community
that the document elsewhere acknowledges will experience indirect eƯects; denial of SRA
status contradicted by the document’s own quoted HMP description; mitigation measures
lacking enforceable performance standards; and complete omission of impact pathways
identiƱed by the species’ own federal recovery framework. The systematic minimization of
this feature’s signiƱcance across multiple analytical dimensions is not the product of
independent professional judgments reaching consistent conclusions.
III. THE CDFW INCIDENTAL TAKE PERMIT ISSUE IS UNRESOLVED
The Focused IS/MND identiƱes CDFW as a trustee agency that may need to issue an
Incidental Take Permit for Crotch’s bumble bee. MM BIO-2 provides that if the Project
“cannot avoid the established no-disturbance buƯer(s),” the applicant “shall consult with
CDFW on appropriate avoidance actions and obtain an Incidental Take Permit if
necessary.”
If an ITP is required, CDFW must make its own CEQA Ʊndings as a responsible agency
before issuing the permit. The Focused IS/MND does not address whether this document -
limited by SB 131 to the environmental eƯects of a single condition - provides adequate
CEQA coverage for CDFW’s independent responsible agency obligations. This procedural
gap creates uncertainty about whether the document can serve its intended function if
CDFW determines that a discretionary ITP action is required.
IV. SYSTEMATIC PATTERN OF MINIMIZATION
The individual deƱciencies documented above are not isolated analytical errors. They form
a unidirectional pattern. Across the biological resources analysis—the sole discipline
reviewed under the SB 131 framework, every analytical choice trends toward a less-than-
signiƱcant determination and in favor of project approval:
Reliance on a single two-hour winter survey as the sole current Ʊeld eƯort; use of twenty-
two-year-old focused surveys in lieu of current blooming-period surveys for a federally
listed plant with critical habitat on-site; failure to conduct protocol surveys for a federally
listed bird conƱrmed resent; internal inconsistenc in habitat characterization for a state
1 16
(cont.)
1 17
1 18
Pa e 2-10
Comment Letters and Responses to Comments
Salk Avenue Apartments Project
candidate endangered species; deferral of species presence/absence determinations to
post-approval mitigation; omission of indirect impact analysis for a sensitive natural
community that the document elsewhere acknowledges will experience indirect eƯects;
complete omission of predation, cowbird parasitism, habitat connectivity, altered
hydrology, and invasive species impact pathways identiƱed in the species’ own federal
recovery framework; denial of SRA status contradicted by the document’s own quoted HMP
description; and mitigation measures lacking enforceable performance standards for listed
species.
No counterdirectional Ʊnding was identiƱed. No instance was found where the document
overstated an impact, applied a more protective standard than warranted, or erred in a
direction that disfavored the project.
This unidirectional pattern is independently signiƱcant under Sierra Club v. County of
Fresno (2018) 6 Cal.5th 502, 515–516, as it demonstrates that the IS/MND does not serve
CEQA’s informational purpose. The pattern is particularly consequential here because the
SB 131 near-miss framework concentrates the entire CEQA analysis on biological
resources, the single discipline where the pattern of minimization is most pronounced. The
document that was supposed to provide rigorous, focused biological analysis as the
tradeoƯ for exempting every other environmental topic from review has instead produced
the least reliable analysis in the record.
V. CONCLUSION AND REQUESTED ACTIONS
The administrative record contains substantial evidence supporting a fair argument that
the Project may have signiƱcant eƯects on biological resources. The record also
demonstrates that the Project does not satisfy the statutory eligibility criteria for the SB 131
near-miss pathway, given (a) the presence of three species under three regulatory
frameworks constituting multiple conditions under Section 21080.66(a)(6)(J), and (b) the
potential second disqualifying condition of NCCP conservation lands under Section
65913.4(a)(6)(I).
I respectfully requests that the City:
1. Withdraw the Focused IS/MND and conduct full CEQA review through a comprehensive
Initial Study or Environmental Impact Report addressing all environmental topics, on the
grounds that the Project fails the AB 130 exemption due to multiple conditions and does
not qualify for SB 131 near-miss treatment;
1 18
(cont.)
1 19
Pa e 2-11
Comment Letters and Responses to Comments
Salk Avenue Apartments Project
2. In the alternative, if the City maintains the single-condition framework, substantially
revise the Focused IS/MND to include: (a) protocol-level gnatcatcher surveys per the
USFWS protocol; (b) current blooming-period surveys for thread-leaved brodiaea within the
designated critical habitat; (c) pre-approval focused surveys for Crotch’s bumble bee; (d)
analysis of all indirect impact pathways identiƱed in this letter, including predation,
cowbird parasitism, artiƱcial lighting, altered hydrology, invasive species, and habitat
connectivity, with reference to the USFWS Recovery Implementation Strategy and Draft
Recovery Plan; and (e) enforceable mitigation measures with minimum performance
standards for all listed and candidate species; and
3. Refrain from adopting the Focused IS/MND until all tribal consultations under AB 52 are
complete and CDFW has conƱrmed whether an Incidental Take Permit will be required for
Crotch’s bumble bee.
This letter is submitted for inclusion in the administrative record for the Project.
Respectfully submitted,
Jim
jkmiller7@proton.me
1-20
1-21
Pa e 2-12
Comment Letters and Responses to Comments
Salk Avenue Apartments Project Page 2-13
Responses to Comments from Jim Miller
Response to Comment 1-1
The City acknowledges that the project site contains, or could support, three special-status
species or habitats, all of which have been thoroughly evaluated in the IS/MND. According to
CEQA exemption criteria, these are considered collectively as “habitat for protected species,”
which is a single disqualifying factor under Government Code Section 65913.4(a)(6)(J). Pursuant
to AB 130, the City evaluated whether these biological conditions constitute more than one
disqualifying factor. The City does not agree that these three special-status species/habitats
should be viewed as “multiple conditions” within the law; instead, it is a single environmental topic
(biological resources) with several components included, each fully addressed. Therefore, the AB
130/SB 131 Focused IS/MND remains valid, and the project’s biological impacts have been
avoided or minimized to less than significant levels with implementation of the identified mitigation
measures.
Response to Comment 1-2
The City’s HMP designates three Special Resource Areas (SRAs) citywide, and the project site is
located in SRA 1. Importantly, SRA 1 is not a hardline preserve or conservation easement
designated for permanent conservation; rather, it is an area recognized for biological importance
but largely comprised of private lands where development can occur as a covered activity under
the HMP, subject to certain requirements. The Biological Resources Technical Report explicitly
states, “The project site is a covered activity under the City of Carlsbad HMP and is located in
SRA 1. However, the project site is not within a HMP Hardline Conservation Area or HMP
Proposed Hardline Conservation Area.” This is also illustrated on Figure 5, Existing Hardline
Conservation Areas, and Figure 6, Proposed Hardline Conservation Areas, of Section D,
Conservation Strategy, of the City HMP. Further, as illustrated on HMP Figure 28, Habitat
Management Plan, the project site is designated as a “Development Area,” not a “Conservation
Area.”1 This means that while the general area is known to have high biological value, the project
site, as well as areas located east, south, and west of the project site, were not set aside solely
for conservation under the HMP. In fact, the site is anticipated for development by the City (it was
previously graded in 2007 for a prior project and is also identified for residential development as
Site 7 in the City’s Housing Element; see also HMP Figure 28), and thus it is included as part of
the HMP’s “covered projects” with specific mitigation obligations. Moreover, as stated in the City
HMP Appendix B, Section 2, Definitions, “Proposed Hardline Areas” is defined as, “Properties
whose conservation and development areas have been planned as part of the HMP, as depicted
on Figure 6 These areas have been agreed-upon in coordination with the landowners, the City,
U.S. Fish and Wildlife Service, and the California Department of Fish and Game [now known as
the California Department of Fish and Wildlife or CDFW].” In summary, the project site is not
identified in the HMP as a Core Area, Linkage Area, or Hardline Conservation Area and is not
proposed for preservation by the City.
Therefore, the City does not consider the presence of an SRA designation – absent inclusion in
a preserve – to be equivalent to “lands identified for conservation” in the context of SB 131,
1 City of Carlsbad. Habitat Management Plan for Natural Communities in the City of Carlsbad. Final approved December 1999; as
amended and approved November 2004.
https://www.carlsbadca.gov/home/showpublisheddocument/1600/638366818940500000.
Comment Letters and Responses to Comments
Salk Avenue Apartments Project Page 2-14
especially since development within SRAs is allowed with mitigation. Since the project site is not
designated for conservation in the HMP, the near-miss eligibility condition under Government
Code Section 65913.4(a)(6)(I) is not triggered.
Response to Comment 1-3
As stated above, the City does not concur with the assertion that there are two (or more) separate
disqualifying conditions. Both the presence of multiple special-status species and the HMP SRA
context fall under the singular “biological resources” category for SB 131 purposes. Each of the
commenter’s concerns has been addressed through the focused biological analysis.
Neither the multi-species presence nor the SRA context creates a scenario where the project
would cause unmitigated significant impacts or where an Environmental Impact Report (EIR)
would be required for biological resources. As stated in Response to Comment 1-2, a property
within an SRA does not automatically equate to a property being within a hardline preserve or
conservation easement designated for permanent conservation; rather, an SRA is an area
comprised of private lands where development can occur as a covered activity under the HMP,
subject to certain requirements. As stated in the project-specific Biological Resources Technical
Report, “The project site is a covered activity under the City of Carlsbad HMP and is located in
SRA 1. However, the project site is not within a HMP Hardline Conservation Area or HMP
Proposed Hardline Conservation Area.”
As such, the SB 131 near-miss approach is appropriate for this project, given that all other CEQA
exemption criteria are met and the biological resources impacts have been reduced to a less than
significant level with mitigation.
Response to Comment 1-4
The IS/MND baseline was established through multiple steps: comprehensive literature and
database review, field habitat assessment, and analysis of focused surveys from previous
projects. The IS/MND did not “conclude no significant impact” simply due to lack of data; rather,
it used all available data (including historical surveys and current habitat conditions) to inform its
significance determinations. In cases of uncertainty, the analysis erred on the side of caution by
assuming presence and built in appropriate mitigation measures accordingly. The City does not
consider this an inappropriate deferral, but a CEQA-compliant strategy to deal with potential
species presence.
Regarding Crotch’s bumble bee, a site-specific three-survey protocol design was approved by
CDFW in April 2026. The three subsequent surveys were conducted in April and May 2026.
Crotch’s bumble bee was not detected in any of the three surveys and the negative findings were
reported to CDFW.
Response to Comment 1-5
The IS/MND’s determination of no significant impact regarding thread-leaved brodiaea is
supported by substantial evidence: (a) focused surveys conducted during the species’ bloom
period in 2001 and 2003 yielded negative results on what is now the project site; (b) the only
potential habitat the 0.33-acre Diegan coastal sage scrub area remains undeveloped and
would not be subject to grading; and (c) regional mitigation for brodiaea impacts under the Fox
Miller project has already been implemented. The City, however, acknowledges that the January
2025 survey was conducted outside the March-through-June blooming period and therefore
Comment Letters and Responses to Comments
Salk Avenue Apartments Project Page 2-15
cannot be solely relied upon for presence/absence determination. However, comprehensive
surveys from 2001 and 2003 did not detect thread-leaved brodiaea on what is now the project
site.
Moreover, grading and fill activities on site in 2007 likely removed or buried any suitable clay soils
required by this edaphic specialist species. According to the Biological Resources Technical
Report, the current site soils primarily consist of imported fill and loam, rather than the native clay
subsoil necessary for brodiaea viability.
Although the IS/MND considered the potential for occurrence as high within the Diegan coastal
sage scrub patch due to habitat characteristics and historical records, no significant impacts to
thread-leaved brodiaea was concluded based on the absence of documented individuals, the age
of the critical habitat record, and preservation of the Diegan coastal sage scrub patch from project
disturbance. The current project does not affect areas known to host or conserve thread-leaved
brodiaea under the HMP.
Response to Comment 1-6
The commenter’s concern about the two-hour January 2025 survey is acknowledged. A single
survey would not typically show the use in all seasons; however, the City’s biologists relied on
evidence from current conditions, historical data, habitat suitability, and professional judgment.
Most special-status species were excluded from further review in the IS/MND because the site
lacks suitable habitat or is outside their range not just due to absence during one survey. The
Biological Resources Technical Report appendix lists these species with reasons for their
expected absence or low likelihood. The SB 131 review focused on resources likely present:
coastal California gnatcatcher, Crotch’s bumble bee, thread-leaved brodiaea, and the Diegan
coastal sage scrub habitat. The baseline characterization is considered sufficient as it highlights
the key issues addressed by mitigation and further study. As noted above in Response to
Comment 1-4, subsequent protocol surveys for Crotch’s bumble bee were negative.
Response to Comment 1-7
A protocol survey was not conducted prior to finalizing the IS/MND. The January 2025 habitat
assessment confirmed the presence of at least one gnatcatcher on site, which established the
need for protective measures regardless of the precise number of individuals or nests. The City
acknowledges the USFWS Coastal California Gnatcatcher Presence/Absence Survey Protocol,
which generally recommends a minimum of six breeding-season survey visits between March 15
and June 30 to document territory boundaries, pair status, and nesting activity. However, it is
important to note that Carlsbad is within an area covered by a Natural Communities Conservation
Program (i.e., the City HMP) that covers coastal California gnatcatcher, and as such, only three
breeding-season survey visits would be required, rather than six. While protocol surveys provide
valuable data on territory boundaries, pair status, and nesting locations, confirmation of species
presence is sufficient to trigger protective mitigation under CEQA. Accordingly, the City is
assuming presence of coastal California gnatcatcher on-site. As stated in revised MM BIO-1 (refer
to Response to Comment 1-8), site-specific measures shall be implemented to avoid and
minimize impacts.
MM BIO-1 establishes clear performance standards to avoid and minimize indirect impacts to
gnatcatchers, including protection of active nests and limitation of construction-related
disturbance. The mitigation measure requires installation of a 500-foot no-disturbance buffer
Comment Letters and Responses to Comments
Salk Avenue Apartments Project Page 2-16
around any active coastal California gnatcatcher nest identified by a qualified biologist and
implementation of construction controls to ensure disturbance levels remain below thresholds that
could adversely affect nesting behavior. Consistent with USFWS guidance, these performance
standards are intended to meet or exceed commonly recommended buffers and construction
noise limits during the breeding season, unless a qualified biologist determines that site-specific
conditions support an alternative protective distance or additional measures. The City
acknowledges that USFWS guidance commonly recommends a minimum 500-foot buffer around
active gnatcatcher nests and includes construction noise thresholds intended to limit disturbance
during the breeding season. USFWS guidance also allows these buffers and noise controls to be
refined based on site-specific conditions, nest location, topography, intervening screening, and
the nature of construction activities. In no circumstances shall a buffer of less than 100 feet be
used even with noise attenuation measures. Any reduction in the 500-foot no-disturbance buffer
must be supported by site-specific analysis by the qualified biologist and approved by the City in
consultation with USFWS. As a result, MM BIO-1 ensures that protective measures consistent
with USFWS recovery objectives will be implemented, and the absence of a pre-approval protocol
survey will not result in any unmitigated significant impact. Because the coastal California
gnatcatcher is a covered species by the City HMP, the HMP holistically addresses species
concerns on a broader ecosystem scale. By establishing a citywide preserve system with core
areas interconnected with wildlife movement corridors, the City is protecting the gnatcatcher at
buildout and in perpetuity, while allowing development in appropriate places.
For other nesting bird species (other than the coastal California gnatcatcher), if active nests are
observed during the pre-construction nesting bird survey, an avoidance buffer shall be determined
by a qualified biologist in coordination with the City. The avoidance buffer width will depend upon
the species, the proposed work activity, and existing disturbances associated with land uses
outside of the project site.
Response to Comment 1-8
MM BIO-1 was originally formulated to be flexible, recognizing that appropriate buffer distances
can depend on factors such as avian behavior, location of the nest, existing ambient noise, and
the nature of construction activity.
To directly address the concern raised, the City has updated MM BIO-1 (Pre-Construction Nesting
Bird Surveys, Avoidance, and Notification) to require that, if a gnatcatcher nest is found during
pre-construction surveys, a minimum 500-foot wide no-disturbance buffer be established around
the nest and maintained until a qualified biologist confirms that the young have fledged, the nest
is no longer active, or that construction noise levels can be maintained below 60 dBA Leq at the
nest site with a smaller buffer. For purposes of this mitigation measure, a “qualified biologist” is
defined as a professional biologist with demonstrated experience conducting nesting bird surveys
in southern California coastal habitats and familiarity with the identification, behavior, and nesting
ecology of avian species known to occur in the region, including federally listed species such as
the coastal California gnatcatcher. By incorporating these specifics – a numeric distance, noise
criteria, and biologist qualifications MM BIO-1 would have clear performance standards.
Specifically, MM BIO-1 from the public review IS/MND stated:
MM BIO-1 Pre-Construction Bird Surveys, Avoidance, and Notification.If construction
activities are initiated during the bird nesting season (February 1–August 31)
involving removal of vegetation or other nesting bird habitat, including abandoned
Comment Letters and Responses to Comments
Salk Avenue Apartments Project Page 2-17
structures and other man-made features, a pre-construction nesting bird survey
shall be conducted no more than 14 days prior to initiation of ground disturbance
and vegetation removal activities. The nesting bird pre-construction survey shall
be conducted on foot and shall include a 300-foot survey buffer around the
construction site. The survey shall be conducted by a biologist familiar with the
identification of avian species known to occur in southern California coastal
communities (i.e., qualified biologist). If active nests are found, an avoidance buffer
shall be determined by a qualified biologist in coordination with the City. The
avoidance buffer width will depend upon the species, the proposed work activity,
and existing disturbances associated with land uses outside of the site, which shall
be demarcated by the biologist with bright orange construction fencing, flagging,
construction lathe, or other means to demarcate the boundary. All construction
personnel shall be notified as to the existence of the buffer zone and to avoid
entering the buffer zone during the nesting season. No ground-disturbing activities
shall occur within the buffer until the biologist has confirmed that breeding/nesting
is completed, and the young have fledged the nest. Encroachment into the buffer
shall occur only at the discretion of the qualified biologist on the basis that the
encroachment will not be detrimental to an active nest. A report summarizing the
pre-construction survey(s) shall be prepared by a qualified biologist and shall be
submitted to the City prior to the commencement of construction activities.
Note: To mitigate the potential impact to California gnatcatcher or other nesting
birds, this mitigation measure shall be applied to land use and activities occurring
at the project site. No Pre-Construction Bird Surveys, Avoidance, and Notification
mitigation is required to implement the Study Area-Off-Site Sewer Line portion of
the project.
MM BIO-1 has been revised as follows (the preconstruction survey window has been modified to
no sooner than three days prior to ground disturbance, and the second paragraph is newly added
text):
MM BIO-1 Pre-Construction Nesting Bird Surveys, Avoidance, and Notification.If
construction activities are initiated during the bird nesting season (February 1–
August 31) involving removal of vegetation or other nesting bird habitat, including
abandoned structures and other man-made features, a pre-construction nesting
bird survey shall be conducted no more than three days prior to initiation of ground
disturbance and vegetation removal activities. The nesting bird pre-construction
survey shall be conducted on foot and shall include a 300-foot survey buffer around
the construction site. The survey shall be conducted by a biologist familiar with the
identification of avian species known to occur in southern California coastal
communities (i.e., qualified biologist). If active nests are found, an avoidance buffer
shall be determined by a qualified biologist in coordination with the City. The
avoidance buffer width will depend upon the species, the proposed work activity,
and existing disturbances associated with land uses outside of the site, which shall
be demarcated by the biologist with bright orange construction fencing, flagging,
construction lathe, or other means to demarcate the boundary. All construction
personnel shall be notified as to the existence of the buffer zone and to avoid
entering the buffer zone during the nesting season. No ground-disturbing activities
shall occur within the buffer until the biologist has confirmed that breeding/nesting
Comment Letters and Responses to Comments
Salk Avenue Apartments Project Page 2-18
is completed, and the young have fledged the nest. Encroachment into the buffer
shall occur only at the discretion of the qualified biologist on the basis that the
encroachment will not be detrimental to an active nest. A report summarizing the
pre-construction survey(s) shall be prepared by a qualified biologist and shall be
submitted to the City prior to the commencement of construction activities.
If an active coastal California gnatcatcher nest is found during pre-construction
surveys, a minimum 500-foot no-disturbance buffer shall be established around
the nest. The buffer shall be clearly marked (e.g., with fencing or flagging) and
maintained until a qualified biologist confirms that the young have fledged, the nest
is no longer active, or that construction noise levels can be maintained below 60
dBA Leq at the nest site with a smaller buffer. In no circumstances shall a buffer of
less than 100 feet be used even with noise attenuation measures. Any reduction
in the 500-foot buffer must be supported by site-specific analysis by the qualified
biologist and approved by the City in consultation with the US Fish and Wildlife
Service.
Note To mitigate the potential impact to California gnatcatcher or other nesting
birds, this mitigation measure shall be applied to land use and activities occurring
at the project site. No Pre-Construction Nesting Bird Surveys, Avoidance, and
Notification mitigation is required to implement the Study Area-Off-Site Se er Line
portion of the project.
It is also noted that such clarification to MM BIO-1 does not represent “significant new information”
as defined in CEQA Guidelines Section 15088.5. The revised MM BIO-1 is more effective than
that presented in the Draft IS/MND. Therefore, recirculation of the IS/MND prior to adoption is not
required (CEQA Guidelines Sections 15073.5[c][1] and 15074.1).
Response to Comment 1-9
The 0.33-acre Diegan coastal sage scrub patch located in the northwest corner of the site is
classified as a sensitive natural community. The IS/MND determined there was no impact on this
community because the project avoids any direct removal or disturbance of this Diegan coastal
sage scrub patch. Indirect impacts addressed in Threshold (f) included potential edge effects on
adjacent habitats according to the Carlsbad HMP Adjacency Standards. These standards apply
to any project next to a preserve or sensitive area and require actions to limit indirect effects like
lighting, invasive species, noise, human activity, predator management, erosion, and hydrology.
These measures were built into the project’s design pursuant to the City’s HMP, Objective Design
Standards, and Landscape Manual and are detailed in the IS/MND, especially in the analysis of
HMP policy compliance and standard features. As a result, indirect impacts were not ignored
rather, they were managed through commitments to protective measures.
To further clarify this issue, the City has updated the IS/MND so that Threshold (b) references the
HMP Adjacency Standards and related protective measures. Because these protections are part
of the project and would be enforced, the “no significant impact” finding remains valid: the project
would not significantly harm the nearby Diegan coastal sage scrub habitat, either directly or
indirectly. The habitat would be preserved, with adjacency protective measures guarding against
edge effects and preventing major degradation of this sensitive community.
Comment Letters and Responses to Comments
Salk Avenue Apartments Project Page 2-19
Response to Comment 1-10
Refer to Response to Comment 1-7. The City has carefully reviewed each of the commenter’s
cited potential indirect impacts to the gnatcatcher. One coastal California gnatcatcher was
observed in 2025 in the 0.33-acre Diegan coastal sage scrub patch located in the northwest
corner of the site, which would be avoided by the project. The consulting biologist concluded that
the individual was transient, most likely residing in the more abundant and established habitat
opposite Salk Avenue and using the patch for foraging.
It is important to note that the coastal California gnatcatcher is a covered species by the City HMP,
and the HMP holistically addresses species concerns on a broader ecosystem scale. By
establishing a citywide preserve system with core areas interconnected with wildlife movement
corridors, the City is protecting the gnatcatcher at buildout and in perpetuity, while allowing
development in appropriate places.
We provide responses to each point below:
x Predation by Domestic Cats:The risk of pet (particularly cat) predation on wildlife,
including to birds, is a known issue in urban-wildland interfaces. Coastal California
gnatcatchers primarily occupy coastal sage scrub characterized by dense, low-growing
shrub cover, where nests are typically placed several feet above ground within intact
vegetation, limiting exposure to urban predators. Predation pressure documented for the
species is primarily associated with avian predators and habitat fragmentation, and
domestic cats are not identified by USFWS as a common or significant source of
gnatcatcher mortality.2 Additionally, predation by domestic cats on birds and other wildlife
is a recognized issue primarily associated with single-family residential development,
where cats can freely exit homes and roam yards and adjacent open space. In contrast,
a multi-level apartment building is inherently not conducive to free-roaming cats, as pets
cannot independently open doors or access elevators to enter or exit units. As a result,
cats residing in multi-family developments are predominantly, if not entirely, indoor pets,
substantially reducing the likelihood of access to adjacent habitat. Moreover, the HMP
Adjacency Standards explicitly require that projects adjacent to preserves implement
measures to manage pets and potential predators of developments adjacent to preserve
area. Consistent with these requirements, the project would include provisions to further
minimize any already low potential for pets entering the adjacent habitat, including the
following:
o Resident Education:In compliance with the City’s HMP Adjacency standards, the
project applicant would provide educational materials (e.g., brochures or handbook
provisions) to all new residents informing them of the nearby sensitive habitat and
requiring cats be kept indoors, with outdoor access permitted only if leashed and
under direct supervision.
o Landscape Management:The project’s landscape plan would avoid planting
features that might inadvertently attract domestic animals to the habitat edge (e.g.,
no litter boxes near open space, no features that encourage house pets to roam
2 US Fish and Wildlife Service (USFWS). Coastal California Gnatcatcher Species Profile.https://www.fws.gov/story/coastal-
california-gnatcatcher.
Comment Letters and Responses to Comments
Salk Avenue Apartments Project Page 2-20
near the preserve boundary). Additionally, it is noted that the habitat patch is
relatively small and bordered on two sides by existing development or roads. While
the City can manage pet-related risks through project design and adherence to the
City’s HMP, the project’s incremental contribution to domestic cat presence near
the preserve would be negligible.
x Brown-Headed Cowbird Brood Parasitism:Cowbirds (Molothrus ater) are known brood
parasites that can affect songbirds like the gnatcatcher by laying eggs in their nests. The
City acknowledges that the USFWS 1993 listing rule for the gnatcatcher identified cowbird
parasitism as a contributing threat, and the July 2025 Recovery Implementation Strategy,
which serves as an adaptable, action-oriented document under the USFWS’s three-part
framework, focusing on specific implementation actions to recover listed threatened or
endangered species, includes cowbird control as a Priority 3 recovery action (Action 7).
However, no substantial evidence supports the assertion that construction of an apartment
complex in the urbanized Carlsbad environment would measurably increase brown-
headed cowbird brood parasitism on species (and specifically, the coastal California
gnatcatcher) in the on-site Diegan coastal sage scrub habitat. Neither the City’s HMP nor
the North County Multiple Habitat Conservation Program identifies cowbird predation as
a significant threat to gnatcatcher populations in this region. In fact, the HMP only mentions
cowbird control as a general preserve-wide management guideline alongside broader
edge-effect provisions not as a species-specific threat for gnatcatcher in the plan area.
The commenter has provided no site-specific data no cowbird abundance counts, nest
parasitism rates, or monitoring results to substantiate a causal link between the project
and a “substantial increase” in cowbird parasitism. Cowbird concentrations require large-
scale food subsidies (e.g., livestock feed, open agriculture, extensive lawns, etc.). Per
project design, the proposed apartment complex in an urbanized area with fully enclosed
trash rooms, regularly scheduled trash removal, and no dumpsters accessible from the
outside would not create these conditions. As such, potential impacts under Threshold (f)
would remain less than significant.
x Habitat Connectivity and Fragmentation:The Focused IS/MND concluded that the
project would have no impact on wildlife movement or migration corridors. This conclusion
was based on site-specific conditions: the project site is isolated by existing development
and roads, and is not part of any large, continuous wildlife corridor. The City acknowledges
the commenter’s citation to the USFWS Draft Recovery Plan for the Coastal California
Gnatcatcher (2025) and the Recovery Implementation Strategy. However, the HMP
describes SRA 1 (which includes the site) as “too small, edge-effected, or isolated to be
considered biological cores or linkage areas,” which supports the conclusion that the area
is not a critical transit corridor for wildlife. The Draft Recovery Plan (2025) emphasizes
maintaining connectivity between habitat patches for long-term species viability. The City
agrees that habitat connectivity is important at a landscape scale. However, in this case
the on-site habitat is extremely limited (0.33 acres) and bordered by existing urban
development. It is not part of a larger open space continuum; to the north is Salk Avenue
and a designated Hardline Preserve (from which it is separated by the road), and to the
south and east are developed parcels. To the west lies a golf course (maintained turf is
not suitable gnatcatcher habitat). In essence, the project site’s Diegan coastal sage scrub
patch is an isolated “island” of habitat. As noted in the Biological Resources Technical
Report, “there are no landscape features or vegetative cover that would support wildlife
Comment Letters and Responses to Comments
Salk Avenue Apartments Project Page 2-21
movement... the site does not serve as a habitat linkage or wildlife corridor.” Further, as
previously stated in Responses to Comments 1-2 and 1-3, the project site is not identified
in the HMP as a Core Area, Linkage Area, or Hardline Conservation Area and is not
proposed for preservation by the City.
Additionally, the project would not introduce new barriers such as wide roads or fencing
across any natural habitat that would impede wildlife movement. The building and
hardscape would be largely confined to the already graded pad. A final point of clarification
is that the broad north-south corridor identified in the MHCP regional framework is
associated with larger patches of habitat in the vicinity (e.g., around Lake Calavera,
riparian corridors, etc.), not with the SRA 1 patch at the project site. The USFWS Recovery
Implementation Strategy Priority 2 actions that address enhancing connectivity in North
County are aimed at regional planning (connecting larger preserves), rather than
maintaining every minor fragment. By complying with the HMP, the City is contributing to
that larger connectivity goal through established preserves and mitigation banks.
Therefore, the IS/MND’s finding remains sound: the project would not significantly interfere
with wildlife movement or fragment an existing corridor. The on-site habitat patch will
maintain any limited role it has in connectivity. No additional mitigation is necessary
because the project’s footprint does not intersect any identified corridor and because
standard HMP adjacency requirements (fencing, sensitive lighting, etc.) would ensure the
new development does not create undue edge effects that could exacerbate regional
fragmentation.
Response to Comment 1-11
The IS/MND addressed lighting through design commitments pursuant to the City’s Objective
Design Standards: all project outdoor light fixtures will be fully shielded, downward-facing, and
directed away from the adjacent habitat, consistent with HMP requirements. Energy-efficient
fixtures incorporating light emitting diode (LED) lamps or equivalent energy-efficient fixtures would
be used for outdoor lights near the habitat. The project site is located within an urbanized area of
the City where existing nighttime conditions already include nighttime lighting associated with
nearby roadways and commercial/industrial development. As such, a five-story building with
windows and traditional light sources would not introduce lighting in an undisturbed natural
environment. With respect to building-related lighting and window glow, illumination would be
consistent with other residential developments in the City. Lighting would be shielded, directed
downward, and limited to the minimum necessary for safety and security, reducing light spill and
skyglow. Vehicle headlights within the parking structure would be intermittent, contained within
the structure, and similar to conditions already present in other multi-story residential and
mixed-use developments. Given the urban context of the site, the absence of adjacent conserved
habitat, and compliance with applicable City development standards consistent with the HMP,
project lighting would not substantially alter existing nighttime conditions or result in adverse
effects to wildlife. Accordingly, lighting impacts would be less than significant.
Response to Comment 1-12
The prevention of invasive non-native plant and animal introduction is another aspect of the HMP
Adjacency Standards that the project must follow. The project’s landscape plans will be reviewed
and approved by the City to ensure the plans meet the requirements set forth in the City’s
Comment Letters and Responses to Comments
Salk Avenue Apartments Project Page 2-22
Landscape Manual. No invasive plant species (as listed by California Invasive Plant Council or
the Carlsbad HMP) would be planted adjacent to the on-site open space. The project would use
only native or drought-tolerant, non-invasive landscaping for the areas near the habitat. The
comment mentions irrigation overspray and fertilizer runoff as potential issues; the City’s standard
Storm Water Best Management Practices will address those concerns, requiring efficient irrigation
design (preventing overspray) and integrated pest management to avoid chemical runoff.
Additionally, the on-site 0.33-acre habitat patch would be buffered from the development by open
space and any necessary physical barriers, which reduces the chance of direct encroachment by
invasive plants.
Response to Comment 1-13
The project avoids direct impacts to the 0.33-acre patch of Diegan coastal sage scrub that
overlaps designated critical habitat for thread-leaved brodiaea, and no individuals of the species
have been observed on-site in past or current surveys. Additionally, the State Water Resources
Control Board has adopted General Permit No. CAS000002 – Waste Discharge Requirements
for Discharges of Storm Water Runoff Associated with Construction Activity (General Permit) for
California, which applies to most construction-related stormwater discharges within California.
The General Permit requires that projects disturbing greater than one acre develop and implement
a Stormwater Pollution Prevention Plan that specifies best management practices (BMPs) to be
used during project construction. Implementation of the BMPs would ensure runoff and
discharges during the project construction phase would not violate any water quality standards.
Additionally, the project would be required to implement a project-specific Water Quality
Management Plan that identifies BMPs for the management of urban stormwater runoff, including
design criteria for treatment control. Compliance with the project-specific Stormwater Pollution
Prevention Plan and Water Quality Management Plan would ensure that construction-related and
operational impacts on water quality would be less than significant.
Response to Comment 1-14
With regard to Crotch’s bumble bee habitat, the 0.33-acre area located in the northwest corner of
the site is the only place with any potential bumble bee habitat present, and that small area is not
being developed as part of the project. When the IS/MND refers to “lack of suitable nectaring and
nesting habitat” in the context of direct impacts, it is referring to the fact that within the project’s
construction footprint (i.e., the areas to be graded or built upon), there are no high-quality nectar
sources or intact soils for bumble bees. All such resources are in the small 0.33-acre area to be
left untouched. Thus, no direct mortality or physical destruction of a bumble bee nest is anticipated
from construction, supporting the statement that direct impacts are not expected. Additionally, as
noted in Response to Comment 1-4, CDFW-approved protocol surveys were conducted in April
and May 2026 and Crotch’s bumble bee was not detected.
Response to Comment 1-15
The IS/MND and Biological Resources Technical Report are consistent in stating that the project
site lies within the geographical boundaries of SRA 1 but that the property itself is not an HMP
conservation area. The IS/MND and the Biological Resources Technical Report have been
revised to clarify this point. Refer also to Response to Comment 1-2. These changes would not
result in a new significant impact and do not represent “significant new information” as defined in
CEQA Guidelines Section 15088.5. Therefore, recirculation of the IS/MND prior to adoption is not
required (CEQA Guidelines Section 15073.5[c][1]).
Comment Letters and Responses to Comments
Salk Avenue Apartments Project Page 2-23
Response to Comment 1-16
The 0.33-acre Diegan coastal sage scrub patch is indeed a central feature in the project’s
biological considerations. Far from minimizing its importance, the City’s analysis recognized it as
environmentally sensitive and made it the cornerstone of the mitigation strategy through
avoidance and protective measures. The following points highlight how the IS/MND addressed
the resources associated with this limited area:
x The site plan was deliberately designed to exclude the 0.33-acre Diegan coastal sage
scrub habitat from development. By not building on this area, the project would avoid direct
impacts to Diegan coastal sage scrub, gnatcatcher habitat, and any species using that
habitat. Avoidance is the most effective mitigation, and it was the first measure applied.
x One coastal California gnatcatcher was observed in 2025 in the 0.33-acre Diegan coastal
sage scrub patch located in the northwest corner of the site, which would be avoided by
the project. The consulting biologist concluded that the individual was transient, most likely
residing in the more abundant and established habitat opposite Salk Avenue and using
the patch for foraging. The IS/MND requires seasonal avoidance of the area if nesting is
observed during preconstruction nesting bird surveys and buffering it from construction
disturbance (refer to MM BIO-1). The adequacy of the buffer and mitigation has been
addressed above in Response to Comment 1-7.
x The Diegan coastal sage scrub patch’s role as potential Crotch’s bumble bee habitat and
thread-leaved brodiaea critical habitat has been addressed in Responses to Comments
1-4, 1-5, and 1-14. The patch would not be disturbed. CDFW-approved protocol surveys
were conducted in April and May 2026 and Crotch’s bumble bee was not detected.
x The patch is within SRA 1; however, it is not designated in the City HMP as a permanent
conservation site. As illustrated on HMP Figure 28, Habitat Management Plan, the project
site is designated as a “Development Area,” not a “Conservation Area.” The HMP
specifically calls out the importance of conserving Brodiaea filifolia in SRA 1; however, no
thread-leaved brodiaea populations are known to exist in the patch. Nevertheless, the
project’s avoidance would keep the habitat available.
x The presumed “no impact” finding for indirect effects on the patch is not a dismissal of
those effects, but rather a reflection that, with standard project design features in place
and adherence to the City’s development requirements, including the City HMP, City
Objective Design Standards, and City Landscape Manual, indirect effects would be
rendered less than significant (see above). Responses to Comments 1-9 through 1-13
above detail how issues like lighting, noise, pets, and runoff are being managed for this
patch. The key protective City requirements built into project design include buffering,
shielding (for light), controlling human and pet access, and monitoring.
In summary, the City does not agree that there was a “systematic minimization” of this feature’s
importance. On the contrary, a primary focus of the analysis relates to the 0.33-acre patch and
the species it may support. Further, the mitigation measures (MM BIO-1 and MM BIO-2) are aimed
at protecting the resources in or adjacent to this area. The project’s avoidance of the patch is a
strong protective step.
Comment Letters and Responses to Comments
Salk Avenue Apartments Project Page 2-24
Response to Comment 1-17
The City acknowledges CDFW’s role as a responsible agency with regard to a potential ITP for
Crotch’s bumble bee (which is currently a candidate species under the California Endangered
Species Act). CDFW approved of a site-specific Crotch’s bumble bee survey protocol consisting
of three surveys spaced at least two weeks apart. The surveys were conducted in April and May
2026 with no bees detected.
Response to Comment 1-18
The City does not concur that there was a “systematic bias” in the analysis. On the contrary, the
approach was science-based and precautionary. When in doubt, the analysis presumed the
resource may be present or impacted and required mitigation accordingly. Additionally, as stated
in Response to Comment 1-2, the site was previously graded in 2007 for a prior project and is
also identified for residential development as Site 7 in the City’s Housing Element (see also HMP
Figure 28), and thus was analyzed for environmental affects in the City’s Housing Element
Implementation and Public Safety Element Update Supplemental EIR. Further, the project site is
included as part of the HMP “covered projects” with specific mitigation obligations. The absence
of identified significant impacts in the project-specific IS/MND is a result of effective project design
and mitigation, not a failure to look for impacts. The City would carry forward all commitments
made in the IS/MND and in these responses into the final project approval and monitoring
requirements. Therefore, an EIR is not warranted for biological resources, as the IS/MND provides
a complete and adequate analysis of potential impacts and mitigation measures for the site’s
biological issues.
Response to Comment 1-19
The City believes that a fully informed, good-faith revised analysis of the project’s biological
resources has been achieved without the need for an EIR. After implementing the avoidance and
mitigation measures – many of which are built into the project by design and adhere to the City’s
development requirements, including the City HMP, City Objective Design Standards, and City
Landscape Manual – impacts on biological resources are not significant. For instance, no
sensitive habitat would be removed; listed species are either absent or would be protected in
place if present; and indirect effects from the new development on adjacent habitat are avoided
or reduced through proven measures (lighting controls, noise reduction, invasive species
management, etc.). Refer also to Responses to Comments 1-1 through 1-3.
Response to Comment 1-20
Please refer to Response to Comment 1-7 above for reasoning why protocol-level gnatcatcher
surveys are not required for the project. Refer to Response to Comment 1-5 for the explanation
why current blooming-period surveys for thread-leaved brodiaea within the designated critical
habitat is not necessary. See Response to Comment 1-4 regarding the comment about requiring
pre-approval focused surveys for Crotch’s bumble bee. Refer to Responses to Comments 1-9
through 1-13 regarding the analysis of indirect impacts related to predation, cowbird parasitism,
artificial lighting, altered hydrology, invasive species, and habitat connectivity. See Response to
Comment 1-8 regarding the commenter’s previous comment on enforceable mitigation measures.
Comment Letters and Responses to Comments
Salk Avenue Apartments Project Page 2-25
Response to Comment 1-21
Tribal Consultation was initiated with all tribes consulting with the City under AB 52 on January 5,
2026. Consultation was requested by the Rincon Band of Luiseño Indians and conducted through
a series of letters and meetings. The City coordinated with the tribe, and an agreement was made
that the tribe will provide tribal cultural monitoring during ground-disturbing construction activities
associated with the project. As such, AB 52 consultation has concluded. Refer to Response to
Comment 1-4 regarding Crotch’s bumble bee concerns.
Comment Letters and Responses to Comments
Salk Avenue Apartments Project
Comment Letters and Responses to Comments
Salk Avenue Apartments Project
Letter 2
"1B38
I<5+1>!55EG5>(5>9?B%<1>>5B "9;5(DB?>79B53D?B
%<1>>9>79F9C9?> ?==E>9DI5F5<?@=5>D5@1BD=5>D
?==E>9DI5F5<?@=5>D5@1BD=5>D9DI?61B<C214
9DI?61B<C214
1B141IF5>E5
1B141IF5>E51B<C214
1B<C214
=9;5CDB?>731B<C214317?F
;I<5F1><55EG5>31B<C214317?F
@<1>>9>731B<C214317?F
&
0..&/50/5)&0$64&%/*5*"-56%9*5*("5&%&("5*7&&$-"3"5*0/'03
5)&"-,7&/6&1"35.&/5430+&$50
!0
51B"B+1>!55EG5>1>4"B(DB?>7
)89C3?==5>D9CCE2=9DD54?>2581<6?6(E@@?BD5BC<<91>356?B>F9B?>=5>D1<
'5C@?>C929<9DIM('NB571B49>7D85?3EC54>9D91<(DE4I "9D971D54#571D9F553<1B1D9?>
M"#N@B5@1B546?BD85(1<;F5>E5@1BD=5>DC%B?:53D(%#?
+#?
<?31D54?>(1<;F5>E551CD?6?<<575?E<5F1B41>4G5CD?6<1=9>?'51<9>
1B<C2141<96?B>91M%B?:53DN
C49C3ECC5425<?GD85B59C1619B1B7E=5>DD81DD85%B?:53D=1IB5CE<D9>C97>96931>D
14F5BC529?<?7931<9=@13DC)85B56?B5('B5C@53D6E<<IB5AE5CDCD81DD859DI?61B<C214
M9DIN@B5@1B51>5>F9B?>=5>D1<9=@13DB5@?BDM'N256?B51@@B?F9>7D85%B?:53DD?
@B?@5B<I1>1<IJ51>4=9D971D5D85C59=@13DC9>133?B41>35G9D8D851<96?B>91>F9B?>=5>D1<
&E1<9DI3DM&N
('PCB5F95G?6D85"#G1C1CC9CD542I5H@5BDG9<4<96553?<?79CDB(81G>
(=1<<G??4%8B(=1<<G??4PCGB9DD5>3?==5>DC1>4+1B51DD1385485B5D?1CH8929D
1>41B59>3?B@?B1D5485B59>2IB565B5>359>D859B5>D9B5DI
)85%B?53D9>F?<F5CD853?>CDBE3D9?>?61>5G 69F5CD?B 6??DD1<<C E1B5
Page 2-26
Comment Letters and Responses to Comments
Salk Avenue Apartments Project
Comment Letters and Responses to Comments
Salk Avenue Apartments Project
6??DB5C945>D91<45F5<?@=5>D9>3<E49>7
=E<D961=9<I4G5<<9>7E>9DC1>4
CAE1B5655D?6
?ED4??B?@5>C@1351CG5<<1C1>12?F57B?E>469F5<5F5<
CAE1B56??D@1B;9>7
CDBE3DEB5G9D8@1B;9>7C@135C)85%B?:53DC9D53?F5BC12?ED13B5C?6F131>D1>4
E>45F5<?@54<1>4)85C9D59C<?31D54?>(1<;F5>E551CD?6?<<575?E<5F1B41>4G5CD?6<
1=9>?'51<9>D859DI?61B<C214(EBB?E>49>7<1>4EC5C9>3<E459>4ECDB91<2E9<49>7CD?D85
51CD1>4C?ED81@B9F1D54B9F9>7B1>751>47?<66139<9DID?D85G5CD1>41=54931<?669352E9<49>7
D?D85>?BD8)85C9D59C<?31D54G9D89>D851B141I1B<C2145>D5B(@539693%<1>1B51
45C97>1D541C'5C945>D91<E>45BD855>5B1<%<1>1>4J?>54'5C945>D91<5>C9DI"E<D9@<5'
"
CD851<96?B>91(E@B5=5?EBD85<4M/906>?'81C255>@B5@1B546?B1>?>5H5=@D
@B?:53D2EDCE2CD1>D91<5F945>359>D85B53?B4CE@@?BDC1619B1B7E=5>DD81DD85@B?:53D=1IB5CE<D
9>C97>96931>D14F5BC59=@13DCD85@B?@5BB5=54I9CD??B45B@B5@1B1D9?>?61>'N
&$$+% * )&(**( %,0*,&+*&)* (+# *.$* )*
1<D8
M(97>96931>D5>F9B?>=5>D1<56653DN9C4569>54F5BI2B?14<I1CM1CE2CD1>D91<?B
@?D5>D91<<ICE2CD1>D91<14F5BC5381>759>D855>F9B?>=5>DN%E2'5C?45/M%'N0K
C551<C?1<96?B>91?45?6'57E<1D9?>C/M'N0K
>56653D?>D855>F9B?>=5>D
>554>?D25M=?=5>D?ECND?=55DD85&D5CD6?BC97>96931>359D9C5>?E78D81DD859=@13DC
1B5M>?DDB9F91<N& #
%, *.&&)%#)
1<
4
M)85O6?B5=?CD
@B9>39@<5P9>9>D5B@B5D9>7&9CD81DD85!579C<1DEB59>D5>454D8513DD?25B514C?1CD?166?B4
D856E<<5CD@?CC92<5@B?D53D9?>D?D855>F9B?>=5>DG9D89>D85B51C?>12<5C3?@5?6D85CD1DED?BI
<1>7E175N&$$+% * )&(**( %,0*,#)%.
1<@@D8
)85'9CD85F5BI851BD?6&"() # * /%)&(&#&%*(&#, *.&
"() #
1<@@D8&"*(&**&(), *.&($%*&
1<@@D8
)85'9C1>M5>F9B?>=5>D1<O1<1B=25<<PG8?C5@EB@?C59CD?1<5BD
D85@E2<931>49DCB5C@?>C92<5?669391<CD?5>F9B?>=5>D1<381>75C256?B5D85I81F5B513854D85
53?<?7931<@?9>DC?6>?B5DEB>N"() # * /%))+'(1<@@D81D
)85'
1<C?6E>3D9?>C1C1M4?3E=5>D?6133?E>D129<9DIN9>D5>454D?M45=?>CDB1D5D?1>1@@B585>C9F5
39D9J5>BID81DD85175>3I81C9>613D1>1<IJ541>43?>C945B54D8553?<?7931<9=@<931D9?>C?69DC
13D9?>N+(# *)
$'(&,$%*)))%,%*)&% ,<
4
)85'@B?35CCM@B?D53DC>?D?><ID855>F9B?>=5>D2ED1<C?9>6?B=54C5<67?F5B>=5>DN
&"*(&**&()1<@@D8
>'9CB5AE9B5496MD85B59CCE2CD1>D91<5F945>359><978D?6D85G8?<5B53?B4256?B5
D85<514175>3ID81DD85@B?:53D=1I81F51C97>96931>D56653D?>D855>F9B?>=5>DN%'K
4C551<C?&"*(&**&()CE@B11<@@D81D>"#9>CD514?61>
'9C@B?@5B?><I96@B?:53DB5F9C9?>CG?E<41F?94?B=9D971D5D85@?D5>D91<<IC97>96931>D56653DC
945>D969549>D859>9D91<CDE4IMD?1@?9>DG85B53<51B<I>?C97>96931>D56653D?>D855>F9B?>=5>D
G?E<4?33EB1>4D85B59C>?CE2CD1>D91<5F945>359><978D?6D85G8?<5B53?B4256?B5D85
@E2<93175>3ID81DD85@B?:53D1CB5F9C54=1I81F51C97>96931>D56653D?>D855>F9B?>=5>DN
! , *.&&)%#)
1<@@D8
/AE?D9>7%'KK
30>D81D3?>D5HDM=1IN=51>C1B51C?>12<5@?CC929<9DI?61C97>96931>D56653D?>D85
5>F9B?>=5>D%'KK
1
1&"*(&**&())+'(1<@@D8
FRQW
Page 2-27
Comment Letters and Responses to Comments
Salk Avenue Apartments Project
Comment Letters and Responses to Comments
Salk Avenue Apartments Project
1D+&((&** &%&"#%)* )*&( ), *.&"#%
1<@@D8
>'=ECD25@B5@1B54B1D85BD81>1>"#MG85>5F5B9D31>25619B<I1B7E54?>D85
21C9C?6CE2CD1>D91<5F945>35D81DD85@B?:53D=1I81F51C97>96931>D5>F9B?>=5>D1<9=@13DN&
#
%, *.&&)%#)
1<
4*>45BD89CM619B1B7E=5>DNCD1>41B41>
'9CB5AE9B54961>ICE2CD1>D91<5F945>359>D85B53?B49>4931D5CD81D1@B?:53D=1I81F51>
14F5BC55>F9B?>=5>D1<56653DL5F5>963?>DB1BI5F945>355H9CDCD?CE@@?BDD85175>3IPC4539C9?>
'K
6&"*(&**&())+'(1<@@D81D
*% )#+)++&%
& *.,&+%*.&*% )#+)
1<@@D8
+ #&*% #(%)
&+%
%, *.& % % *)1<@@D8
)85M619B1B7E=5>DN
CD1>41B43B51D5C1M<?GD8B5C8?<4N61F?B9>75>F9B?>=5>D1<B5F95GD8B?E781>'B1D85BD81>
D8B?E789CCE1>35?6>571D9F5453<1B1D9?>C?B>?D935C?65H5=@D9?>6B?=&&"*
(&**&()CE@B11<@@D81D
)85M619B1B7E=5>DNCD1>41B49CF9BDE1<<ID85?@@?C9D5?6D85DI@931<4565B5>D91<CD1>41B4
133?B454D?175>395CC1<5149>7&DB51D9C55H@<19>C
)89CO619B1B7E=5>DPCD1>41B49CF5BI49665B5>D6B?=D85CD1>41B4>?B=1<<I6?<<?G542I
@E2<93175>395C9>=1;9>714=9>9CDB1D9F545D5B=9>1D9?>C$B49>1B9<I@E2<93175>395C
G5978D855F945>359>D85B53?B4256?B5D85=1>4B513814539C9?>21C54?>1
@B5@?>45B1>35?6D855F945>35/9D1D9?>C0)85619B1B7E=5>DCD1>41B42I3?>DB1CD
@B5F5>DCD85<514175>3I6B?=G59789>73?=@5D9>75F945>35D?45D5B=9>5G8?81C1
25DD5B1B7E=5>D3?>35B>9>7D85<9;5<98??4?B5HD5>D?61@?D5>D91<5>F9B?>=5>D1<9=@13D
)85<514175>3IPC4539C9?>9CD8EC<1B75<I<571<B1D85BD81>613DE1<9D4?5C>?DB5C?<F5
3?>6<93DC9>D855F945>352ED45D5B=9>5C?><IG85D85BCE2CD1>D91<5F945>355H9CDC9>D85
B53?B4D?CE@@?BDD85@B5C3B9254619B1B7E=5>D
?CD;1.9C83;5(* %( K@@
)85?EBDC81F55H@<19>54D81D
M9D9C1AE5CD9?>?6<1G>?D613DG85D85B1619B1B7E=5>D5H9CDC1>4D853?EBDC?G5>?4565B5>35
D?D85<514175>3IPC45D5B=9>1D9?>'5F95G9C45>?F?G9D81@B565B5>356?BB5C?<F9>74?E2DC9>
61F?B?65>F9B?>=5>D1<B5F95GN&"*(&**&()CE@B11<@@D81D
)&3&*446#45"/5*"-&7*%&/$&0'"'"*3"3(6.&/55)"55)&30+&$5."9)"7&
4*(/*'*$"/5"%7&34&*.1"$540/#*0-0(*$"-3&4063$&4
H@5BDG9<4<96553?<?79CD(81G>(=1<<G??4%881CB5F95G54D85%B?:53DD85"#
D85"#PC29?<?7931<1>1<IC9C@B5@1B542I"93815<1;5B>D5B>1D9?>1<M"N1>4?D85B
B5<5F1>D4?3E=5>DCB571B49>7D85%B?:53DC49C3ECC5425<?GB(=1<<G??46?E>4D81DD85
%B?:53DG9<<C97>96931>D<I9=@13D29?<?7931<B5C?EB35C2531EC5D85"#E>45B5CD9=1D54D85
49F5BC9DI?6C@5395C@B5C5>D?>D85%B?:53DC9D59>3<E49>7=E<D9@<5C@5391<CD1DECC@5395CD85B5
9CCE2CD1>D91<5F945>35?61619B1B7E=5>DD81DD85%B?:53DG9<<14F5BC5<I16653D29?<?7931<
B5C?EB35C1>4
D85"#PC@B?@?C54=9D971D9?>=51CEB5C1B59>145AE1D5D?CE669395>D<IB54E35
FRQW
Page 2-28
Comment Letters and Responses to Comments
Salk Avenue Apartments Project
Comment Letters and Responses to Comments
Salk Avenue Apartments Project
D85%B?:53DPC29?<?7931<9=@13DC
)&'"*-&%50"$$06/5'6--9'035)&%*7&34*590'41&$*&413&4&/50/5)&
30+&$54*5&*/$-6%*/(.6-5*1-&41&$*"-45"56441&$*&4
B(=1<<G??4PC1CC?391D529?<?79CD#?B9;?(=1<<G??4"(F9C9D54D85%B?:53DC9D56?B
1
8?EB49EB>1<CEBF5I?>"1B38
H1DEB9>785BF9C9D"C(=1<<G??4
45D53D54
C@5395C?6F5BD52B1D5G9<4<9651DD85%B?:53DC9D59>3<E49>7C5F5>C@5391<CD1DEC
C@5395C
1D
)85C5C@5391<CD1DECC@5395C9>3<E454D85<<5>PCE==9>729B41>4
D85,B5>D9D2?D89B4C?6?>C5BF1D9?>?>35B>E>45BD85*(9C8,9<4<965(5BF935
D85
??@5BPC1G;1C@5395C?>D851<96?B>915@1BD=5>D?69C8,9<4<965PCM,N)1H1D?
,1D38!9CDM,!N19B4?6%B5I@B?D53D542I1<96?B>919C81=5?45K
M$%N1>41B?E@C@5395C?>D85(1>957??E>DI(5>C9D9F5>9=1<!9CDM(N
D85?E2<5B5CD54?B=?B1>D1,!1>4B?E@(C@5395CD85'54(8?E<45B541G;
1$%1>4B?E@(C@5395CD85'54)19<541G;1$%1>4D851<96?B>91
>1D31D385B1B?E@(C@5395C16545B1<<ID8B51D5>54C@5395C?>D85,PC(@5391<
>9=1<!9CD1>41%B9?B9DI1<96?B>91(@5395C?6(@5391<?>35B>
1D
>3?>DB1CDD?"C(=1<<G??4PCC9D5F9C9DD859DIPC3?>CE<D1>D29?<?79CD"45D53D54
C@5395C?6G9<4<9651DD85%B?:53DC9D56B?=9DCG9<4<965CEBF5I
1D,85B51C"
45D53D54C5F5>C@5395CD81D"C(=1<<G??4494>?D"C(=1<<G??445D53D54
F5BD52B1D5
C@5395CD81D"494>?D
,9D8D85C5DG?CEBF5ICD85D?D1<>E=25B?6F5BD52B1D5G9<4<965
C@5395C45D53D541DD85C9D59>3B51C5CD?=?B5D81>DG935D85>E=25B?6C@5395CD81D"PC
29?<?79CDC45D53D54
"C(=1<<G??4PC1449D9?>1<45D53D9?>CCE775CDD81DD85C9D5CE@@?BDC
=1>I=?B5C@5395CI5DD?2545D53D54
B(=1<<G??46?E>4?D85B4569395>395C9>D85"PCCEBF5I69>49>7C1CG5<<?B
5H1=@<5856?E>4D81D"3?>4E3D54>?2B5549>7C51C?>45D53D9?>CEBF5IC6?B2EBB?G9>7
?G<C>?B494D85"3?>4E3D1>I45D53D9?>CEBF5IC6?BD85B?D38PCE=2<555131>4941D5
C@5395C6?B<9CD9>7E>45BD851<96?B>91>41>75B54(@5395C3DM(N?B6?BB1B5@<1>DC
3?>6<93D9>7G9D8D85,PCB53?==5>41D9?>C
1D449D9?>1<<I"B5@?BD549DC
69>49>7CG9D8?ED1>I3?=@1B1D9F53?>D5HDD?1949>9>D5B@B5D1D9?>
)859DI=ECD@B5@1B51>
'C?D81D1CE669395>DCEBF5I566?BD31>253?=@<5D54
EBD85B=?B5B(=1<<G??43?>3<E454D81D"PC45C;D?@B5F95GG1C9>145AE1D51>4
9>3?=@<5D5
1D5C;D?@B5F95G9>3<E45C<9D5B1DEB51>441D121C5B5F95GC1>43?>CE<D1D9?>
G9D8<?31<5H@5BDCD?9>6?B=695<4CEBF5IC945>D96IG8938?D85BC@5395C3?E<4?33EB1DD85%B?:53D
C9D51>49>D5B@B5D1@B?:53DPC9=@13DC?>G9<4<965
B(=1<<G??46?E>4D81D"PC45C;D?@
B5F95GG1C49CD?BD54D?=9>9=9J5D85<9;5<98??4?6D85?33EBB5>35?6C@5391<CD1DECC@5395C
>1449D9?>"B5<954?>?><I?>541D121C59>9DC45C;D?@B5F95GD851<96?B>91#1DEB1<
9F5BC9DI1D11C5M#N1>4619<54D?3?>CE<D?D85B1F19<12<541D121C5CD?1E7=5>D9DC
9>D5B@B5D1D9?>?69DC69>49>7C
#9C1M@?C9D9F5C978D9>741D121C5ND81DM4?5C>?D
@B5493DG85B5C?=5D89>7=1I256?E>4N
B(=1<<G??4>?D54D81D2IB5<I9>7?><I?>
#"=9CEC54#1>4C3B55>54?ED=1>IC@5391<CD1DECC@5395C6B?=6EBD85B
3?>C945B1D9?>9>381B13D5B9J9>7D85%B?:53DC9D5PCG9<4<9653?==E>9DI
B?=89C?G>
FRQW
Page 2-29
Comment Letters and Responses to Comments
Salk Avenue Apartments Project
Comment Letters and Responses to Comments
Salk Avenue Apartments Project
1CC5CC=5>D21C54?>41D121C5B5F95GC1>4"C(=1<<G??4PCC9D5F9C9DCB(=1<<G??45CD9=1D54
D81D
C@5391<CD1DECG9<4<965C@5395C1B5;>?G>D??33EB3<?C55>?E78D?D85%B?:53DC9D5D?
G1BB1>D1>1<IC9C?6D859B?33EBB5>35@?D5>D91<
1D
&B5AE9B5C7?F5B>=5>D175>395CD?45C3B925D85M5>F9B?>=5>D1<C5DD9>7N?6D85
%B?:53D&E945<9>5CK
4! , *.&&)%#)
1<@@D8
)85M5>F9B?>=5>D1<C5DD9>7N9C4569>541CMD85@8IC931<3?>49D9?>CG89385H9CDG9D89>D85
1B51G8938G9<<2516653D542I1@B?@?C54@B?:53D9>3<E49>7<1>419BG1D5B=9>5B1<C6<?B1
61E>11=295>D>?9C51>4?2:53DC?689CD?B93?B15CD85D93C97>96931>35N&E945<9>5CK
C55&E945<9>5CK
*&+)
#)+, *.&%*(+/
1<@@D8
I619<9>7D?@B?F9451>I3?=@1B1D9F53?>D5HDD?9>D5B@B5D
9DCCEBF5IB5CE<DC1>4B5<I9>7?>1>9>CE669395>D45C;D?@B5F95G"9>145AE1D5<I45C3B9254D85
%B?:53DPCM5>F9B?>=5>D1<C5DD9>7N1>4D85B52I9>CE669395>D<I1>1<IJ54D85%B?:53DPC29?<?7931<
9=@13DCB(=1<<G??4CD1D54D81DMG9D8?ED1=?B5133EB1D5381B13D5B9J1D9?>?6D85G9<4<965
3?==E>9DID8521C9C9C9>145AE1D56?B@B5493D9>79=@13DC1>46?B=E<1D9>71@@B?@B91D5=9D971D9?>
CDB1D5795CNH1D
)859DID85B56?B5=ECD@B5@1B51>'D?@B?@5B<I381B13D5B9J5D85
G9<4<9653?==E>9DI?6D85%B?:53DC9D5
9F5>"C(=1<<G??4PC945>D96931D9?>?61D<51CDC5F5>C@5391<CD1DECC@5395C?>D85
%B?:53DC9D51CG5<<1CD85B53?B4C?6D85?33EBB5>35?6=E<D9@<5?D85BC@5391<CD1DECC@5395C>51B
D85C9D5B(=1<<G??4455=54D85C9D51C8129D1D6?BC@5391<CD1DECC@5395C
1DEBD85B
&B5F95GD8B?E781>'9C>55454D?1@@B?@B91D5<I1CC5CC1>4B54E35D85%B?:53DPC14F5BC5
9=@13DC?>D85G9<4<9653?==E>9DI
)&3&*446#45"/5*"-&7*%&/$&0'"'"*3"3(6.&/55)"55)&30+&$58*--)"7&
4*(/*'*$"/5"%7&34&*.1"$540/#*0-0(*$"-3&4063$&4
B(=1<<G??43?>3<E454D81DD85%B?:53DG9<<81F5C97>96931>D14F5BC59=@13DC?>
29?<?7931<B5C?EB35C9>3<E49>718129D1D<?CC29>D5B65B5>35G9D8G9<4<965=?F5=5>D3
G9<4<96545@B541D9?>2I8?EC531DC429B4G9>4?G3?<<9C9?>=?BD1<9DI5DB16693=?BD1<9DI1>4
6 3E=E<1D9F59=@13DC
)85%B?:53DG9<<81F51C97>96931>D14F5BC59=@13D?>D85B5@B?4E3D9F5
31@139DI?6D85%B?:53DC9D51C1B5CE<D?68129D1D<?CC
B(=1<<G??431<3E<1D54D81DD85<?CC?68129D1D6B?=D85%B?:53DG?E<431EC5D85<?CC?6
29B4>5CD9>7C9D5C1>4>5CD9>71DD5=@DC@5BI51B1<?CCD81DMG?E<4AE1<96I1CC97>96931>D
9=@13DCD81D81F5>?D255>1>1<IJ54N9>D85"#
1D?G5F5BD85C59=@13DCG?E<4>?D
5>4G9D8D859==5491D5>E=5B931<<?CC?6>5CD9>7C9D5C6?BD85B5@B?4E3D9F531@139DI?6D85
%B?:53DC9D5G?E<41<C?25@5B=1>5>D<I<?CDB(=1<<G??45CD9=1D54D81DD85%B?:53DG?E<4
1449D9?>1<<I@B5F5>DD85@B?4E3D9?>?66<547<9>7C1>429B4C@5BI51B
53?>3<E454
D81DMD85<?CC?629B4C@5BI51BG?E<4251<?CC?6C97>96931>D8129D1DF1<E5D81D9C3EBB5>D<I
@B?F94542ID85@B?:53DC9D5N
"?B5?F5B=?CD?6D85C529B4C1B5@B?D53D542ID856545B1<
"97B1D?BI9B4)B51DI3D1>41<96?B>91PC"97B1D?BI9B4%B?D53D9?>3DC?D85<?CC?6D85C5
29B4CMG?E<451C9<IAE1<96I1C1>E>=9D971D54C97>96931>D9=@13DN
)89C9CD8EC1C97>96931>D
FRQW
14F5BC59=@13DD81D=ECD251>1<IJ541>4=9D971D549>1>'
Page 2-30
Comment Letters and Responses to Comments
Salk Avenue Apartments Project
Comment Letters and Responses to Comments
Salk Avenue Apartments Project
)85%B?:53DG9<<81F51C97>96931>D14F5BC59=@13D?>G9<4<9651C1B5CE<D?6
9>D5B65B5>35G9D8G9<4<965=?F5=5>D
,9D8?ED1>ICE@@?BD9>75F945>35D85"#CE==1B9<I3?>3<E45CD81DD85%B?:53DC9D5
4?5C>?DCE@@?BDG9<4<965=?F5=5>D2531EC5D85C9D59C9C?<1D541>4<13;CF575D1D9F53?F5B
1D
?G5F5B"C(=1<<G??4?2C5BF549>85BCEBF5ID81DD85C9D59C3?F5B54G9D8?B>1=5>D1<
F575D1D9?>C31DD5B543?I?D52BEC87B1CC<1>4@<1>DC1>49571>C175C3BE2
5BCEBF5IC
1<C?3<51B<IC8?GD81DG9<4<965EC5D85C9D56?B6?B179>71>43?<<53D9>7>5CD=1D5B91<C
"?B5?F5BD85C9D59C9=@?BD1>DD?G9<4<965=?F5=5>D9>D85B579?>2531EC59DC9C?<1D54>1DEB5
9>3B51C5C9DCF1<E5D?=97B1D?BIG9<4<9652I@B?F949>7CD?@?F5B?@@?BDE>9D95C6?B6?B175B5CD1>4
3?F5B
)85%B?:53DG?E<4D8EC45@B9F5G9<4<965?61<<CE38?@@?BDE>9D95CB(=1<<G??4
6EBD85B6?E>4D81D"B5@?BD54>?CEBF5I?2:53D9F51>49=@<5=5>D54>?CDE4I45C97>CD?45D53D
@1DD5B>C?6G9<4<965=?F5=5>D?BB??CD9>7)8EC"3?<<53D54>?41D1D81DG?E<481F5
CE@@?BD54D85"#PC3?>3<EC9?>CB571B49>7D85C9D5PCF1<E5D?G9<4<965=?F5=5>D>'9C
>55454D?145AE1D5<I144B5CCD85%B?:53DPC9=@13DC?>G9<4<965=?F5=5>D
)85%B?:53DG9<<81F51C97>96931>D14F5BC59=@13D?>G9<4<9651C1B5CE<D?6
8?EC531D@B541D9?>
B(=1<<G??46?E>4D81DD85%B?:53D=1IC97>96931>D<I9=@13D<?31<G9<4<9651C1B5CE<D
?68?EC531D@B541D9?>
)85"#4?5C>?D5CD9=1D5D85>E=25B?6>5GB5C945>DCD81DG?E<4
<9F59>D85%B?:53D?G5F5B21C54?>D85
E>9DCB(=1<<G??431<3E<1D5CD81DD85B5G9<<25
1@@B?H9=1D5<I>5G6B55B?1=9>731DCD81D1B5@B5493D54D?;9<<
F5BD52B1D5G9<4<965@5B
I51B
51<C?>?D54D81D6B55B?1=9>78?EC531DC3?>DB92ED5D?4?G>CDB51=<?149>7?6D85
@1B1C9D5&-&'#)$&%
B(=1<<G??43?>3<E454D81DM/90=@13DCD?G9<4<9656B?=D85
9>DB?4E3D9?>?68?EC531DC9>D?D855>F9B?>=5>DG?E<4258978<IC97>96931>D1>4I5DD85C5
9=@13DCG5B5>?D3?>C945B549>D85( "#N
1D
)85%B?:53DG9<<81F51C97>96931>D14F5BC59=@13D?>G9<4<9651C1B5CE<D?6
29B4G9>4?G3?<<9C9?>C
33?B49>7D?B(=1<<G??4D85%B?:53DG9<<81F51C97>96931>D9=@13D?>29B4C1C1
B5CE<D?6G9>4?G3?<<9C9?>C)85"#494>?D144B5CC?B=9D971D5D85C5@?D5>D91<9=@13DCD?
C@5391<C@5395C29B4C
1D
>1<IJ9>7D85@?D5>D91<9=@13D?>G9<4<965?6G9>4?G3?<<9C9?>C
9C5C@5391<<I9=@?BD1>D2531EC5M/G09>4?G3?<<9C9?>C1B5?6D5>381B13D5B9J541C59D85BD85C53?>4
?BD89B4<1B75CDC?EB35?68E=1>31EC5429B4=?BD1<9DIN
)85%B?:53DG?E<49>DB?4E357<1CCG9>4?GCD??@5>19BC@135D81D9C1>5CC5>D91<@?BD9?>
?629B48129D1D
)85"#4?5C>?D49C3<?C51>ICEB61351B51G9>4?G=51CEB5=5>DC6?BD85
%B?:53D?G5F5BB(=1<<G??4@B5493DCCAE1B5=5D5BC?65HD5B9?B7<1CCG9>4?GC9>D85
%B?:53D
1D
1C54?>D89C5CD9=1D5B(=1<<G??431<3E<1D5CD81DD85%B?:53DG9<<31EC5
29B4451D8C@5BI51B6B?=G9>4?G3?<<9C9?>C
"?CD?6D85@B5493D543?<<9C9?>61D1<9D95C
G?E<42529B4C@B?D53D542ID85"97B1D?BI9B4)B51DI3D1>4D851<96?B>91"97B1D?BI9B4
Page 2-31
Comment Letters and Responses to Comments
Salk Avenue Apartments Project
Comment Letters and Responses to Comments
Salk Avenue Apartments Project
%B?D53D9?>3DMD8EC31EC9>7C97>96931>DE>=9D971D549=@13DCD81DG5B5>?D144B5CC549>D85
( "#N
1D
)85%B?:53DG9<<81F51C97>96931>D14F5BC59=@13D?>G9<4<9651C1B5CE<D?6
3?<<9C9?>CG9D8D851449D9?>1<DB1669375>5B1D542ID85%B?:53D
B(=1<<G??46?E>4D81DD85"#619<54D?144B5CCD85%B?:53DPC@?D5>D91<9=@13DCD?
G9<4<9656B?=B?143?<<9C9?>=?BD1<9DI1C1B5CE<D?69>3B51C54DB1669375>5B1D542ID85%B?:53D
CB(=1<<G??45H@<19>54F5893<53?<<9C9?>C81F5133?E>D546?BD85451D8C?6=1>I
D8?EC1>4C?61=@89291>B5@D9<5=1==1<29B41>41BD8B?@?461E>11>4D859=@13DC81F5?6D5>
255>6?E>4D?25C97>96931>D1DD85@?@E<1D9?><5F5<
B(=1<<G??4@B?F9454C5F5B1<CDE495C
45=?>CDB1D9>7C97>96931>D1>9=1<451D8C4E5D?DB166933?<<9C9?>C9>D85D8?EC1>4C1>>E1<<I@5B
;9<?=5D5BC?6B?14
1D
)85"#494>?D1>1<IJ5G85D85B9>3B51C54DB16693
75>5B1D542ID85%B?:53DG?E<4B5CE<D9>C97>96931>D9=@13DCD?G9<4<965
)85"#4?5C>?DB5@?BDD851>>E1<F5893<5=9<5CDB1F5<54M+")ND81DD85%B?:53D
G?E<475>5B1D5
1D
?G5F5BB(=1<<G??4@B5493D54D81DD85%B?:53DG?E<475>5B1D5
1>>E1<+")
531<3E<1D54D81DD85%B?:53DG?E<431EC51@@B?H9=1D5<ID?
F5BD52B1D5G9<4<96561D1<9D95C@5BI51B4E5D?3?<<9C9?>CG9D8%B?:53D75>5B1D54DB16693
1D
5D85B56?B53?>3<E454D81DMD85@B?:53D75>5B1D54DB16693G?E<431EC5CE2CD1>D91<
C97>96931>D9=@13DCD?G9<4<965N1@?D5>D91<9=@13DD85"#494>?D144B5CC
1D
B
(=1<<G??4PC31<3E<1D9?>C3?>CD9DED5CE2CD1>D91<5F945>35CE@@?BD9>71619B1B7E=5>DD81DMD85
@B?@?C54@B?:53DG?E<4B5CE<D9>@?D5>D91<<IC97>96931>D14F5BC529?<?7931<9=@13DCN
1D
>'9CB5AE9B54D?@B?@5B<I1>1<IJ51>4=9D971D5D89C9=@13D
)85B59C1619B1B7E=5>DD81DD85%B?:53D=1I81F5C97>96931>D3E=E<1D9F5
9=@13DCD81DD85"#619<54D?145AE1D5<I1>1<IJ5
&4?3E=5>DCCE381CD85"#=ECD49C3ECC3E=E<1D9F59=@13DC1>4=9D971D5
C97>96931>D3E=E<1D9F59=@13DC'K
1)89CB5AE9B5=5>D6<?GC6B?=&
(53D9?>
G8938B5AE9B5C169>49>7D81D1@B?:53D=1I81F51C97>96931>D56653D?>D85
5>F9B?>=5>D96
)85@?CC92<556653DC?61@B?:53D1B59>49F94E1<<I<9=9D542ED3E=E<1D9F5<I3?>C945B12<5
OE=E<1D9F5<I3?>C945B12<5P=51>CD81DD859>3B5=5>D1<56653DC?61>9>49F94E1<@B?:53D
1B53?>C945B12<5G85>F95G549>3?>>53D9?>G9D8D8556653DC?6@1CD@B?:53DCD8556653DC
?6?D85B3EBB5>D@B?:53DC1>4D8556653DC?6@B?212<56EDEB5@B?:53DC
%'K
2<571<<I145AE1D53E=E<1D9F59=@13DC1>1<IC9CF95GC1@1BD93E<1B@B?:53D
?F5BD9=51>49>3?>:E>3D9?>G9D8?D85BB5<1D54@1CD@B5C5>D1>4B51C?>12<I6?B5C5512<5
@B?212<56EDEB5@B?:53DCG8?C59=@13DC=978D3?=@?E>4?B9>D5BB5<1D5G9D8D8?C5?6D85@B?:53D
1D81>4
B(=1<<G??46?E>4D81DD85"#619<54D?1CC5CCD85%B?:53DPC3?>DB92ED9?>CD?
3E=E<1D9F59=@13DC?>29?<?7931<B5C?EB35CH1D
"@B?F9454>?<9CD?6@1CD?>7?9>7
FRQW
Page 2-32
Comment Letters and Responses to Comments
Salk Avenue Apartments Project
Comment Letters and Responses to Comments
Salk Avenue Apartments Project
1>46EDEB5@B?:53DC9>D851B511>4>?13DE1<1>1<IC9C?63E=E<1D9F59=@13DC33?B49>7<ID85B5
9C>?5F945>35D?CE@@?BD13?>3<EC9?>D81DD85%B?:53DG9<<>?D81F5C97>96931>D3E=E<1D9F5
9=@13DC?>29?<?7931<B5C?EB35C>'C8?E<425@B5@1B54D?1>1<IJ5D85%B?:53DPC@?D5>D91<<I
C97>96931>D3E=E<1D9F59=@13DC?>29?<?7931<B5C?EB35C
1D
)&:4130104&%.*5*("5*0/.&"463&4"3&*/"%&26"5&5046''*$*&/5-9
3&%6$&5)&30+&$5:4"%7&34&*.1"$540/#*0-0(*$"-3&4063$&4
)?B54E35D85%B?:53DPC14F5BC59=@13DC?>29?<?7931<B5C?EB35CD85"#?665BCDG?
=9D971D9?>=51CEB5C?G5F5BB(=1<<G??46?E>4D81DD85C5=9D971D9?>=51CEB5C1B56<1G54
)8569BCD=51CEB5""$9>F?<F5C@B53?>CDBE3D9?>29B4CEBF5IC1>445D5B=9>1D9?>?6
1F?941>352E665BC6?B>5CD9>729B4C
B(=1<<G??417B554G9D8D85>554D?@5B6?B=@B5
3?>CDBE3D9?>CEBF5IC2ED>?D54D81DD89C=51CEB5G?E<4>?D1F?94D85@5B=1>5>D<?CC?68129D1D
31EC542ID85%B?:53D>?BD85=?BD1<9DI6B?=%B?:53D75>5B1D54DB16693
1D
449D9?>1<<ID85<1>7E175?6D89C=51CEB51<<?GC1C9>7<59>49F94E1<D?=1;5CE2:53D9F5
4539C9?>C?EDC945D85@E2<93PCF95GD?45D5B=9>5D852E665B1B511>4D9=9>76?B1>I79F5>
C@5395C
1D
EBD85B=?B5D85=51CEB5619<CD?4569>5G81D3?>CD9DED5C1AE1<96954
29?<?79CDND?3?>4E3DD85@B53?>CDBE3D9?>CEBF5IC
B(=1<<G??43?>3<E454D81DD89C
=51CEB5<13;C?2:53D9F53B9D5B911>49CD85B56?B5E>5>6?B3512<5
)85C53?>4=51CEB5""$9>F?<F5C1F?941>351>43<51B1>35CEBF5IC6?BD85
B?D38PCE=2<555)89CC@5395C9C131>4941D5C@5395C6?B<9CD9>7E>45BD85(C?9D9C
5CC5>D91<D?9=@<5=5>DD851@@B?@B91D545D53D9?>CEBF5I@EBCE1>DD?D85,
1DB
(=1<<G??46?E>4D81DD89C=9D971D9?>=51CEB59C6<1G542531EC59D9=@B?@5B<I4565BC
@5B6?B=1>35?6D8545D53D9?>CEBF5IE>D9<16D5B@E2<9339B3E<1D9?>?6D85&B5F95G4?3E=5>D
)85CEBF5I9>CD514=ECD253?=@<5D54256?B5@E2<9339B3E<1D9?>?6D85&B5F95G
4?3E=5>DD?5>CEB5@B?@5B1>1<IC9C?6@?D5>D91<9=@13DC1>46?B=E<1D9?>?61@@B?@B91D5
=9D971D9?>
B(=1<<G??41<C?6?E>4>?5F945>359>D85"#D81D1>I566?BDC81F5255>
=145D??2D19>1>9>3945>D1<D1;5@5B=9D6?BD85%B?:53D
)8ECD89C=51CEB59C9>145AE1D5
B(=1<<G??49>CD514?665BCC5F5B1<?D85B=9D971D9?>=51CEB5CD81DD859DIC8?E<4
9=@<5=5>DD?B54E35D85%B?:53DPCC97>96931>D14F5BC59=@13DC?>29?<?7931<B5C?EB35C=?B5
56653D9F5<IC8?E<4D85%B?:53D@B?3554%?D5>D91<=9D971D9?>=51CEB5C9>3<E453?=@5>C1D?BI
8129D1D@B?D53D9?>29B4C1657<1CC1>4G9>4?GDB51D=5>DC>1D9F5@<1>D<1>4C31@9>71>4
3?=@5>C1D?BI=9D971D9?>6?BDB16693=?BD1<9DI9>3<E49>74?>1D9?>CD?G9<4<965B58129<9D1D9?>
6139<9D95C41D
C49C3ECC5412?F5D85B59CCE2CD1>D91<5F945>35CE@@?BD9>71619B1B7E=5>DD81DD85
%B?:53D=1I81F5C97>96931>D14F5BC59=@13DC?>29?<?7931<B5C?EB35C>'9CD85B56?B5
B5AE9B54D?1>1<IJ51>4=9D971D5D85%B?:53DPC@?D5>D91<<IC97>96931>D9=@13DC)8EC('
B5C@53D6E<<IB5AE5CDCD81DD859DI>?DB5<I?>D85"#1>49>CD514@B5@1B51>439B3E<1D51>'
256?B56EBD85B3?>C945B1D9?>?6D85%B?:53D
FRQW
Page 2-33
Comment Letters and Responses to Comments
Salk Avenue Apartments Project
Comment Letters and Responses to Comments
Salk Avenue Apartments Project
(9>35B5<I
'5253311F9C
!$.*'*'-!!%
Page 2-34
Comment Letters and Responses to Comments
Salk Avenue Apartments Project
Comment Letters and Responses to Comments
Salk Avenue Apartments Project
Page 2-35
Comment Letters and Responses to Comments
Salk Avenue Apartments Project
Comment Letters and Responses to Comments
Salk Avenue Apartments Project
Shawn Smallwood, PhD
3108 Finch Street
Davis, CA 95616
Attn: Kyle Van Leeuwen, Senior Planner
City of Carlsbad
Community Development Department
1635 Faraday Avenue
Carlsbad, California 92008
20 March 2026
RE: Salk Avenue Apartments Project
Dear Mr. Van Leeuwen,
I write to comment on potential impacts to biological resources that would result from
development of the proposed Salk Avenue Apartments Project. The project would add
397 apartment units within a 59-foot-tall, five-story building grossing 416,152 square
feet and 541 parking spaces on 9.8 acres on the south side of Salk Avenue in between
College Blvd and El Camino Real in Carlsbad, California. My comments that follow
address my concerns that the Focused Initial Study/Mitigated Negative Declaration
(IS/MND) supported by Michael Baker International (MBI 2026), mischaracterizes the
existing environmental setting, and that its impacts analysis is flawed and its mitigation
measures are inadequate.
My qualifications for preparing expert comments are the following. I hold a Ph.D.
degree in Ecology from University of California at Davis, where I also worked as a post-
graduate researcher in the Department of Agronomy and Range Sciences. My research
has been on animal density and distribution, habitat selection, wildlife interactions with
the anthrosphere, and conservation of rare and endangered species. I authored many
papers on these and other topics. I served as Chair of the Conservation Affairs
Committee for The Wildlife Society – Western Section. I am a member of The Wildlife
Society, and I’ve lectured part-time at California State University, Sacramento. I was
Associate Editor of wildlife biology’s premier scientific journal, The Journal of Wildlife
Management, as well as of Biological Conservation, and I was on the Editorial Board of
Environmental Management. I have performed wildlife surveys in California for thirty-
seven years. My CV is attached.
THE WILDLIFE COMMUNITY AS A BIOLOGICAL RESOURCE
Most environmental reviews pursuant to the California Environmental Quality Act
(CEQA) focus on special-status species because CEQA’s Checklist Evaluation of
Environmental Impacts specifies that such evaluation should prioritize potential
impacts to special-status species. However, an important policy of CEQA is “to prevent
the elimination of fish or wildlife species due to man’s activities, insure that fish and
wildlife populations do not drop below self-perpetuating levels, and preserve for future
generations representations of all plant and animal communities and examples of the
Page 2-36
Comment Letters and Responses to Comments
Salk Avenue Apartments Project
Comment Letters and Responses to Comments
Salk Avenue Apartments Project
major periods of California history.” Pub. Res. Code § 21001(c). Seemingly at odds with
the Checklist Evaluation’s specification, this policy is not restricted to special-status
species; it also applies to wildlife populations and plant and animal communities. In
fact, the CEQA Guidelines Section 21155.1 defines wildlife habitat as “the ecological
communities upon which wild animals, birds, plants, fish, amphibians, and
invertebrates depend for their conservation and protection.” This definition is consistent
with the scientific definition of habitat, which is that portion of the environment that is
used by members of a species for survival and reproduction (Hall et al. 1997). An
essential portion of the environment used by any special-status species is composed of
the collection of other species of plants and wildlife, because these species provide for
special-status species their forage, refugia and nest substrates, and some serve as
ecological mutualists; no special-status species can exist in a vacuum of other wildlife.
The CEQA Checklist Evaluation assigns priority to special-status species to balance
information and cost, but it does not exclude the need to evaluate environmental
impacts to other species, which, after all, are members of the very communities within
which special-status species inter-depend for survival and reproduction.
All wildlife species should be of concern in a CEQA review, but with priority directed to
special-status species. The species I consider to be special-status species are those listed
in California’s Special Animals List inclusive of threatened and endangered species
under the California and federal Endangered Species Acts, candidates for listing under
CESA and FESA, California’s Fully Protected Species, California species of special
concern, and California’s Taxa to Watch List (https://nrm.dfg.ca.gov/FileHandler.ashx?
DocumentID=109406), continental and region-specific US Fish and Wildlife Service
Birds of Conservation Concern (https://www.fws.gov/sites/default/files/documents/
birds-of-conservation-concern-2021.pdf), and naturally rare species such as raptors
protected by California’s Birds of Prey laws, Fish and Game Code Sections 3503, 3503.5,
3505 and 3513 (see https://wildlife.ca.gov/Conservation/ Birds/Raptors).
What follows is a summary of a site visit to detect as many of the species of wildlife as
possible within the short time available. The survey was also intended to detect as many
of the special-status species as possible, but with the understanding that most special-
status species are less readily detectable due to rarity and crypticity. Nonetheless, the
species detected can indicate the ecological integrity of the site and thus the likelihood of
occurrence of special-status species not yet detected.
SITE VISIT
On my behalf, Noriko Smallwood, a wildlife biologist with a Master of Science Degree
from California State University Los Angeles, visited the site of the proposed project for
3 hours of survey from 07:00 to 09:00 hours on 11 March 2026. Noriko walked the site’s
perimeter where accessible, stopping to scan for wildlife with use of binoculars. Noriko
recorded all species of vertebrate wildlife she detected, including those whose members
flew over the site or were seen just off the site. Animals of uncertain species identity
were either recorded to the Genus or higher taxonomic level.
FRQW
Page 2-37
Comment Letters and Responses to Comments
Salk Avenue Apartments Project
Comment Letters and Responses to Comments
Salk Avenue Apartments Project
Conditions were sunny with 4 MPH north wind and temperatures of 51-64 F. The site
has been previously graded and contains annual grassland, coastal sage scrub, and
riparian vegetation (Photos 1 and 2)
Noriko saw Allen’s hummingbird and Anna’s hummingbird (Photos 3 and 4), red-
shouldered hawk and red-tailed hawk (Photos 5 and 6), double-crested cormorant and
ring-billed gull (Photos 7 and ), American crow and Cassin’s kingbird (Photos 9 and
10), northern mockingbird (Photo 11), California scrub-jay and cedar waxwing (Photos
12 and 13), California towhee and spotted towhee (Photos 14 and 15), orange-crowned
warbler and house wren (Photos 16 and 17), wrentit and white-crowned sparrow (Photos
1 and 19), song sparrow (Photo 20), and lesser goldfinch and hooded oriole (Photos 21
and 22). Noriko detected 37 species of vertebrate wildlife at or adjacent to the project
site, including seven species with special status (Table 1).
Photos 1 and 2.Views of the project site, 11 March 2026. Photos by Noriko
Smallwood.
FRQW
Page 2-38
Comment Letters and Responses to Comments
Salk Avenue Apartments Project
Comment Letters and Responses to Comments
Salk Avenue Apartments Project
Photos 3 and 4. Allen’s hummingbird (left), and Anna’s hummingbird (right) on the
project site, 11 March 2026. Photos by Noriko Smallwood.
Photos 5 and 6.Red-shouldered hawk eating a prey item (left), and red-tailed hawk
(right) on the project site, 11 March 2026. Photos by Noriko Smallwood.
FRQW
Page 2-39
Comment Letters and Responses to Comments
Salk Avenue Apartments Project
Comment Letters and Responses to Comments
Salk Avenue Apartments Project
Photos and .ouble-crested cormorant (left), and ring-billed gull (right) on the
project site, 11 March 2026. Photos by Noriko Smallwood.
Photos and . American crow with nest material (left), and assin’s kingbird
(right) on the project site, 11 March 2026. Photos by Noriko Smallwood.
FRQW
Page 2-40
Comment Letters and Responses to Comments
Salk Avenue Apartments Project
Comment Letters and Responses to Comments
Salk Avenue Apartments Project
Photo . Northern mockingbird on the project site, 11 March 2026. Photo by Noriko
Smallwood.
Photos and 3. alifornia scrub-jay (left), and cedar wa wings (right) on the
project site, 11 March 2026. Photos by Noriko Smallwood.
FRQW
Page 2-41
Comment Letters and Responses to Comments
Salk Avenue Apartments Project
Comment Letters and Responses to Comments
Salk Avenue Apartments Project
Photos 4 and 5. alifornia towhees (left), and spotted towhee (right) on the project
site, 11 March 2026. Photos by Noriko Smallwood.
Photos 6 and . range-crowned warbler (left), and house wren (right) on the
project site, 11 March 2026. Photos by Noriko Smallwood.
FRQW
Page 2-42
Comment Letters and Responses to Comments
Salk Avenue Apartments Project
Comment Letters and Responses to Comments
Salk Avenue Apartments Project
Photos and . rentit (left), and white-crowned sparrow (right) on the project
site, 11 March 2026. Photos by Noriko Smallwood.
Photo . Song sparrow with a caterpillar on the project site, 11 March 2026. Photo
.
FRQW
Page 2-43
Comment Letters and Responses to Comments
Salk Avenue Apartments Project
Comment Letters and Responses to Comments
Salk Avenue Apartments Project
Photos and . esser goldfinch with nest material (top), and hooded oriole
(bottom) on the project site, 11 March 2026. Photos by Noriko Smallwood.
Noriko Smallwood certifies that the foregoing and following survey results are true and
accurately reported.
FRQW
Page 2-44
Comment Letters and Responses to Comments
Salk Avenue Apartments Project
Comment Letters and Responses to Comments
Salk Avenue Apartments Project
Table 1. Wildlife that Noriko observed in 3 hours of survey on the project site, 11 March 2026.
Common name Species name Status1 Notes
Great Basin fence lizard
Eurasian collared-dove Non-native
Mourning dove
White-throated swift Flock
Anna’s hummingbird
Allen’s hummingbird BCC Foraged, displayed
Killdeer
Ring-billed gull Flew over
Double-crested cormorant WL, CSD2 Flew over
Great egret Flew over
Cooper’s hawk WL, BOP, CSD1 Flew over just off site
Red-shouldered hawk BOP, CSD1 Ate prey item
Red-tailed hawk BOP
Cassin’s kingbird
Swinhoe’s white eye Non-native
California scrub-jay
American crow Gathered nest material
Tree swallow Just off site
Bushtit Foraged
Wrentit BCC Sang, foraged
Cedar waxwing Many
California gnatcatcher FT, SSC2, CSD1 Just off site
Bewick’s wren
Northern house wren
Northern mockingbird
House finch
Lesser goldfinch Gathered nest material
Dark-eyed junco
White-crowned sparrow Foraged
Song sparrow Foraged
California towhee Copulated
Spotted towhee Foraged
Hooded oriole Foraged
Brown-headed cowbird Flew over
Orange-crowned warbler Just off site
Yellow-rumped warbler
Botta’s pocket gopher Burrows
1 Listed on CDFW’s Special Animals List (https://nrm.dfg.ca.gov/FileHandler.ashx?
DocumentID=109406) as FT = federal threatened; SSCi = California Species of Special Concern
with i = priorities 1, 2 and 3; WL = CDFW’s Taxa to Watch List; BCC = U.S. Fish and Wildlife
Service’s Bird of Conservation Concern (https://www.fws.gov/sites/default/files/documents/birds-
of-conservation-concern-2021.pdf); and BOP = protected by Birds of Prey (California Fish and
FRQW
Page 2-45
Comment Letters and Responses to Comments
Salk Avenue Apartments Project
Comment Letters and Responses to Comments
Salk Avenue Apartments Project
Game Code 3503.5, see https://wildlife.ca.gov/Conservation/Birds/Raptors); CSD1 = Group 1
species on County of San Diego Sensitive Animal List (County of San Diego 2010).
N S S C NN SS NC S
Noriko detected 37 species of vertebrate willdife, which was a large number for the
brevity of her survey effort. All the species in Table 1 would lose habitat as the result of
the project and its replacement of natural ground covers with impervious surfaces.
Smallwood and Smallwood (2023) confirmed this habitat loss by measuring the impacts
of similar developments on species richness and the abundances of wildlife. Smallwood
and Smallwood (2023) directly compared the species and the numbers of animals
observed prior to development to the those observed after development, while they did
the same at control sites. The measured losses of these species resulting from
development is indicative of habitat loss, because habitat is defined as that portion of
the environment that is used for survival and reproduction by members of a species
(Hall et al. 1997), and this use is inferred by observations of the presence of a species
(Smallwood 2002).
However, the species of wildlife Noriko detected at the project site were not the only
species that were present during her survey, as there are always species that are not
detected. To demonstrate this, I fit nonlinear regression models to Noriko’s
accumulation of first detections of vertebrate wildlife species with time into her daytime
surveys to predict the number of species that she would have detected with longer
surveys or perhaps with additional biologists available to assist her. The type of model is
a logistic growth model, which reaches an asymptote that corresponds with the
theoretical maximum number of vertebrate wildlife species that could have been
detected during the survey. The model fit to Noriko’s survey data from the morning of 11
March predicts 4 species of vertebrate wildlife were available to be detected, or 11 more
species than she detected that morning (Figure 1). Noriko’s rate of species detections
exceeded the upper bound of the 95 confidence interval estimated from many other
morning surveys we have completed in southcoast California environments.
Unknown are the identities of the species Noriko missed, but the species that Noriko did
and did not detect on composed only a fraction of the species that would occur at the
project site over the period of a year or longer. This is because many species are seasonal
in their occurrence, some re uire more survey effort because they are highly cryptic, and
the members of other species would visit the site only periodically while patrolling large
home ranges. Surveys on only two days cannot possibly detect all of the species of the
local wildlife community.
At least a year’s worth of surveys would be needed to more accurately report the number
of vertebrate species that occur at the project site, but I only have Noriko’s one survey.
However, by use of an analytical bridge, a modeling effort applied to a large, robust data
set from a research site can predict the number of vertebrate wildlife species that likely
make use of the site over the longer term. This analytical bridge draws inference from
the pattern of species detections more than it does from the research site, and I note
that the pattern, i.e., rate, of species detections is consistent from site to site.
FRQW
Page 2-46
Comment Letters and Responses to Comments
Salk Avenue Apartments Project
Comment Letters and Responses to Comments
Salk Avenue Apartments Project
i e 1.Actual
and predicted
relationships
between the
numbers of
vertebrate wildlife
species detected
and the elapsed
survey time based
on Noriko s visual
scan surveys on 11
March 2026. Note
the confidence
interval orange
applies only to the
morning survey
red line .
As part of my research, I completed a much larger survey effort across 167 km2 of annual
grasslands of the Altamont Pass Wind Resource Area, where from 2015 through 2019 I
performed 721 1-hour visual-scan surveys, or 721 hours of surveys, at 46 stations. I used
binoculars and otherwise the methods were the same as the methods I and other
consulting biologists use for surveys at proposed project sites. At each of the 46 survey
stations, I tallied new species detected with each se uential survey at that station, and
then related the cumulative species detected to the hours (number of surveys, as each
survey lasted 1 hour) used to accumulate my counts of species detected. I used combined
uadratic and simplex methods of estimation in Statistica to estimate least-s uares,
best-fit nonlinear models of the number of cumulative species detected regressed on
hours of survey (number of surveys) at the station: ܴ ൌ ଵ
ଵ ൗାൈሺு௨௦ሻ , where ܴ
represented cumulative species richness detected. The coefficients of determination, r2,
of the models ranged 0. to 1.00, with a mean of 0.97 (95 CI: 0.96, 0.9 ); or in other
words, the models were excellent fits to the data.
I projected the predictions of each model to thousands of hours to find predicted
asymptotes of wildlife species richness. The mean model-predicted asymptote of species
richness was 57 after 11, 57 hours of visual-scan surveys among the 46 stations of my
research site. I also averaged model predictions of species richness at each incremental
increase of number of surveys, i.e., number of hours (Figure 2). On average I would have
Cu
m
u
l
a
t
i
v
e
n
u
m
b
e
r
o
f
w
i
ld
l
i
f
e
s
p
e
c
i
e
s
d
e
t
e
c
t
e
d
0 50 100 150 200 250 300
Minutes into survey
0
5
10
15
20
25
30
35
40
Model prediction; r2 = 0.98
95% CI of morning surveys
LQUHJLRQ
Actual count of species
FRQW
Page 2-47
Comment Letters and Responses to Comments
Salk Avenue Apartments Project
Comment Letters and Responses to Comments
Salk Avenue Apartments Project
detected 12.7 species over my first 3 hours of diurnal surveys at my research site in the
Altamont Pass (3 hours to match the 3 hours Noriko surveyed during daylight hours at
the project site), which composed 22.3 of the predicted total number of species I
would detect with a much larger survey effort at the research site. Given the example
illustrated in Figure 2, the 37 diurnally active species Noriko detected after her 3 hours
of daylight survey at the project site likely represented 22.3 of the species to be
detected after many more visual-scan surveys over another year or longer. With many
more repeat surveys through the year, Noriko would likely detect ͵ ͲǤʹʹ͵ൗ ൌ ͳ
species of vertebrate wildlife in daylight surveys at the site. Assuming Noriko’s ratio of
special-status to non-special-status species was to hold through the detections of all 166
predicted species, then continued daylight surveys would eventually detect 31 special-
status species of vertebrate wildlife.
Because my prediction of 166 species of vertebrate wildlife, including 31 special-status
species, is derived from daytime visual-scan surveys, and would detect few nocturnal
mammals such as bats, the true number of species composing the wildlife community of
the site must be larger. Noriko’s reconnaissance survey should serve only as a starting
point toward characteri ation of the site’s wildlife community, but it certainly cannot
alone inform of the inventory of species that use the site. More surveys are needed than
her one survey to produce an inventory the project site’s wildlife community.
Nevertheless, the large number of species I predict at the project site is indicative of a
relatively species-rich wildlife community that warrants a serious survey effort.
i e . Mean CI
predicted wildlife species
richness, ܴ, as a nonlinear
function of hour long
survey increments across
6 visual scan survey
stations across the
Altamont Pass Wind
esource Area, Alameda
and Contra Costa
Counties, 201 ࣣ201 . Note
that the location of the
study is largely irrelevant
to the utility of the graph
to the interpretation of
survey outcomes at the
project site. It is the
pattern in the data that is
relevant, because the
pattern is typical of the
pattern seen elsewhere.0 20 40 60 80 1000
10
20
30
40
50
Cumulative number of surveys (hours)
(9
5
%
C
I
)
FRQW
Page 2-48
Comment Letters and Responses to Comments
Salk Avenue Apartments Project
Comment Letters and Responses to Comments
Salk Avenue Apartments Project
S N N N N S N
The first step in analysis of potential project impacts to biological resources is to
accurately characteri e the existing environmental setting, including the wildlife
community and any key ecological relationships and known and ongoing threats to
special-status species. A reasonably accurate characteri ation of the environmental
setting can provide the baseline from which to analy e potential project impacts. For
these reasons, characteri ation of the environmental setting, including the project site’s
regional setting, is one of the CEQA’s essential analytical steps. Methods to achieve this
first step typically include (1) surveys of the site for biological resources, and (2) reviews
of literature, occurrence databases and local experts to help predict the occurrences of
special-status species. In the case of the proposed project, these steps were taken,
though not with sufficient rigor, and not interpreted in furtherance of an accurate
characteri ation of the wildlife community.
n onmenta Sett n n o me e Su e s
To CEQA’s primary objective to disclose potential environmental impacts of a proposed
project, the analysis should be informed of which biological species are known to occur
at the proposed project site, which special-status species are likely to occur, and the
limitations of the survey effort directed to the site. Analysts need this information to
characteri e the environmental setting as a basis for opining on, or predicting, potential
project impacts to biological resources. In the case of this project, however, more
surveys were needed, as were more appropriate interpretations of the survey findings.
MBI (2026) conducted a reconnaissance survey on 24 anuary 2026 “to document
existing conditions, conduct a habitat assessment for special-status plant and wildlife
species and sensitive natural communities, and determine the presence of a uatic
resources within the project site.” MBI (2026) deployed two biologists who committed 4
person-hours starting at 0 :30, and they detected 21 species of vertebrate wildlife.
In comparison to MBI’s 21 species detected in 4 person-hours, Noriko detected 37
species of vertebrate wildlife at or immediately adjacent to the project site in 3 hours.
MBI detected seven species that Noriko did not, and Noriko detected 23 species that
MBI did not. With Noriko Smallwood’s survey, the total number of vertebrate wildlife
species detected on the project site increases to 44, or more than twice the number
MBI’s biologists detected. Noriko’s additional species detections suggest that the project
site supports many more species yet to be detected. The accumulation of species
detections remains in the early growth phase.
MBI’s vertebrate wildlife species tally was slightly fewer than the average from among
consultants who survey for wildlife at project sites, whereas Noriko detected 7 more
than we average at project sites (Figure 3). MBI’s tally of special-status species of
vertebrate wildlife e ualed the average among consultant surveys, whereas Noriko
detected one more than we average (Figure 3). This type of comparative analysis is
missing from MBI (2026), but it is needed to understand the meaning of the survey
results.
FRQW
Page 2-49
Comment Letters and Responses to Comments
Salk Avenue Apartments Project
Comment Letters and Responses to Comments
Salk Avenue Apartments Project
i e . re uency distribution of the number of vertebrate wildlife species detected
by consulting biologists left graph and by me and Noriko right graph among
project sites that were surveyed in support of environmental reviews in California.
i e . re uency distribution of the number of special status species of wildlife
detected by consulting biologists left graph and by me and Noriko right graph
among project sites that were surveyed in support of environmental reviews.
0 20 40 60 80 100 120 140 160 180 200
Vertebrate wildlife species detected
0
20
40
60
80
100
120
140 Consultants
Nu
m
b
e
r
o
f
p
r
o
j
e
c
t
s
i
t
e
s
0 10 20 30 40 50 60 70 80 90 1000
20
40
60
80
100
Smallwoods
Nu
m
b
e
r
o
f
p
r
o
j
e
c
t
s
i
t
e
s
= 22.8
= 30.3
Salk Ave Apts (21)
Salk Ave Apts (37)
Vertebrate wildlife species detected
0 5 10 15 20 25 30 35 400
20
40
60
80
100
Special-status species of
vertebrate wildlife detected
Consultants
Nu
m
b
e
r
o
f
p
r
o
j
e
c
t
s
i
t
e
s
0 2 4 6 8 10 12 14 16 18 20 22 24 26 280
10
20
30
40
50
60
70
80
Special-status species of
vertebrate wildlife detected
Smallwoods
Nu
m
b
e
r
o
f
p
r
o
j
e
c
t
s
i
t
e
s
= 4
= 6
Salk Ave Apts (4)Salk Ave Apts (7)
FRQW
Page 2-50
Comment Letters and Responses to Comments
Salk Avenue Apartments Project
Comment Letters and Responses to Comments
Salk Avenue Apartments Project
Three comparative contexts are needed to fully disclose the meanings of survey findings
in the IS/MND. The first is to contextuali e the survey findings relative to the survey
effort, because otherwise it is misleading to insinuate that the species detected were
definitive of the wildlife community. As Figures 1 and 2 demonstrate, additional surveys
contribute to greater accuracy in the characteri ation of the wildlife community,
eventually obtaining the species inventory. (An inventory may not be necessary, but it
helps to disclose the approximate number of species yet to be detected.) That Noriko
could survey briefly and still more than double the number of vertebrate wildlife species
from MBI’s 21 species means that there are many more species yet to be detected. As I
commented above, by analytically bridging Noriko’s survey data to a more extensive
research survey effort, I predict 166 species of vertebrate wildlife, inclusive of 31 special-
status species, and these are the tallies expected of only diurnal surveys. Adding
nocturnal surveys would increase these numbers substantially, as many mammals,
reptiles and amphibians and some birds are active mostly at night.
The second comparative context is to compare the survey findings on the project site to
survey findings from other sites of proposed projects or at sites that can serve as
reference sites. Figures 3 and 4 exemplify this comparative context, as do the confidence
intervals in Figures 1 and 2. Another example can be found in Figure 5, which compares
Noriko’s findings to hundreds of other survey results at other proposed project sites,
developed sites, and at relatively intact “references sites,” but it does so relative to the
survey effort. This approach is more informative than the other comparative contexts
because it factors in survey effort.
The third comparative context is to assess the probabilities of detection considering the
survey effort of each special-status species, whether detected or not. MBI (2026) reports
having failed to detect most special-status species that could conceivably occur on the
project site, but what do these failures to detect species really mean? Each species
presents survey personnel with a uni ue range of detection probabilities, but the
IS/MND fails to discuss this, and instead gives the false impression that field surveys
are e ual in their ikelihoods to detect any and all species of vertebrate wildlife. For any
given species, the likelihood it would be detected varies with survey effort and distance
from known activity areas, among other factors. Many animals maintain home ranges
that are larger than most project sites, and they periodically shift their foraging activities
to various parts of their home range, hence occurring on a particular site only
periodically. To detect these species, survey personnel must be at the site on the same
date and time as the one or more members of the species. Therefore, the probability of
detection during any given survey is less than 100 .
FRQW
Page 2-51
Comment Letters and Responses to Comments
Salk Avenue Apartments Project
Comment Letters and Responses to Comments
Salk Avenue Apartments Project
i e . Noriko Smallwood s survey findings at the Salk Ave Apartments Project site
relative to our survey findings at other project sites red , at developed sites black ,
and at more pristine sites that we survey as reference sites green . Noriko s findings
exceed the upper bound of the confidence interval based on the results of hundreds
of surveys at project sites, and they almost reach the lower bound of the CI from
many surveys at reference sites.
For example, knowing that the nearest eBird occurrence record of white-tailed kite was
within 1.5 miles from the project site, Noriko’s survey effort of 3 hours afforded her a 9
likelihood of detection of white-tailed kite (Figure 6). Noriko would have needed to
conduct another 9 surveys to accumulate a reasonable likelihood of detecting white-
tailed kite, but the model fit to the data indicates that with more surveys she would
eventually detect white-tailed kite on the project site. Assuming for the sake of argument
that the skills of MBI’s biologists were e ual to Noriko’s, then the model predicts MBI’s
likelihood of detection of white-tailed kite is 11 , or not much greater than Noriko’s
detection probability. Both Noriko and MBI stood a low likelihood of detection of white-
tailed kite, but this does not mean that white-tailed kites are unlikely to occur on the
site. There is a fundamental difference between detection likelihood and occurrence
likelihood, but this difference is not mentioned or discussed in MBI (2026).
0 50 100 150 200 250 300
Minutes into survey
0
10
20
30
40
50
60 Early morning surveys for vertebrate wildlife
Reference sites
Proposed project sites
Developed sites
Me
a
n
(
9
5
%
C
I
)
c
u
m
u
l
a
t
i
v
e
s
p
e
c
i
e
s
d
e
t
e
c
t
e
d
Noriko’s morning tally of 37 vertebrate
wildlife species at Salk Ave
FRQW
Page 2-52
Comment Letters and Responses to Comments
Salk Avenue Apartments Project
Comment Letters and Responses to Comments
Salk Avenue Apartments Project
i e .
Probability of
detection of white
tailed kite as a
function of survey
effort and proximity
of occurrence records
to a project site, based
on hundreds of
reconnaissance
surveys we completed
201 202 .
This third comparative context is very important because it is the basis for the
formulation of detection survey protocols. Experienced biologists are aware of survey
limitations due to ranges of variation in the activity periods, levels of crypticity, and
periodic movement patterns of wildlife species, and due to variation in the skill and
commitment of survey personnel. This third comparative context acknowledges that the
occurrence likelihood of a species on a particular site is rarely if ever ero, so long as the
site is within the species’ geographic range and it provides habitat. This third
comparative context reveals that a determination of ero likelihood of occurrence is
typically indicative of insufficient survey effort. A common goal of detection survey
protocols is to support absence determinations with a survey effort that should have
resulted in a detection if the species had been present at the time of the surveys, but it
does not prove that the species is always absent from the site. This third comparative
context and its implications should not be neglected in CEQA review, but in the case of
the IS/MND prepared for this Project, it is entirely neglected.
As for detection surveys, none were implemented on the project site. No breeding-
season detection surveys were implemented for burrowing owl as recommended by
CDFW (2012), none were implemented for candidate species of bumble bee as
recommended by CDFW (2023), and none were implemented for rare plants as
Log10 Survey hours
-0.6 -0.2 0.2 0.6 1.0 1.4 1.8 2.2
0.2
0.4
0.6
0.8
1.0
0
Pr
o
b
a
b
i
l
i
t
y
o
f
d
e
t
e
c
t
i
o
n
1.5 and 40 miles
Within 1.5 miles
On site or adjacent
Nearest eBird records
White-tailed kite (ODQXV OHXFXUXV
California Fully Protected
0.4 158410 Hours1
P = 0.09
FRQW
Page 2-53
Comment Letters and Responses to Comments
Salk Avenue Apartments Project
Comment Letters and Responses to Comments
Salk Avenue Apartments Project
recommended by CDFW (201 ). A meandering 2-hoour walk by two biologists could not
have effectively substituted for protocol-level detection surveys.
In summary, MBI detected the usual number of wildlife species that consultants detect
in surveys conducted in support of CEQA review, but Noriko’s survey brings the species
tally to 44 species of vertebrate wildlife, and it indicates many more occur there but have
yet to be documented. It is delin uent of MBI (2026) to have reported its findings
without any comparative context to aid in interpretation. At least a fair argument can be
made for the need to prepare an EIR so that a sufficient survey effort can be completed
and its results appropriately interpreted and reported.
n onmenta Sett n n o me es to e e
The purpose of literature and database reviews and of consulting with local experts is to
inform the field survey, and to augment interpretation of its outcome. Analysts need this
information to identify which species are known to have occurred at or near the project
site, and to identify which other special-status species could conceivably occur at the site
due to geographic range overlap and migration flight paths. In the case of this project,
the desktop review was incomplete, and the review that was completed was distorted to
minimali e the likelihoods of occurrence of special-status species.
To establish its pool of special-status species for assessment of occurrence likelihoods,
MBI (2026) ueried the California Natural Diversity Data Base (CNDDB) for occurrence
records within eight USGS 7.5’ Quadrangles. However, the CNDDB is a volunteer
positive-sightings database, and as such it is useful for confirming presence but not for
confirming absence of species because such databases are not designed for this purpose.
As noted by the CNDDB, “The CN B is a positive sighting database. It does not
predict where something may be found. We map occurrences only where we have
documentation that the species was found at the site. There are many areas of the state
where no surveys have been conducted and therefore there is nothing on the map. That
does not mean that there are no special status species present.” MBI (2026) and hence
the IS/MND misuse the CNDDB.
The CNDDB relies entirely on volunteer reporting from biologists who were allowed
access to whatever properties they report from. Many properties have never been
surveyed by biologists. Many properties have been surveyed, but the survey outcomes
never reported to the CNDDB. Many properties have been surveyed multiple times, but
not all survey outcomes reported to the CNDDB. Furthermore, the CNDDB is interested
only in the findings of special-status species, which means that species more recently
assigned special status will have been reported many fewer times to the CNDDB than
were species assigned special status since the inception of the CNDDB. Therefore,
occurrence records in the CNDDB are most abundant for species assigned special status
decades ago, but fewest for species only recently assigned special status. And because
negative findings are not reported to the CNDDB, the CNDDB is also inappropriate as a
basis for weighting occurrence likelihoods such as absent, not expected, unlikely, low,
moderate or high. Whereas the CNDDB can be confirmatory of species presence, it
cannot support absence determinations or assignments of low likelihood of occurrence.
FRQW
Page 2-54
Comment Letters and Responses to Comments
Salk Avenue Apartments Project
Comment Letters and Responses to Comments
Salk Avenue Apartments Project
And again, the screening out of a species due to lack of occurrence records in the
CNDDB is the same as an absence determination, and this step is being taken without
ade uate support of field surveys.
In my assessment based on a database review and site visits, 143 special-status species
of wildlife are known to occur near enough to the site to warrant analysis of occurrence
potential (Table 2). Not all these species should be expected to occur at the project site,
but each of them should be given a closer look to determine occurrence likelihoods and
whether additional surveys are needed, or implementation of detection surveys, or
whether it would be reasonable to assume presence. Of these 143 species, (6 ) were
recorded on or just off the project site, and another 47 (33 ) species have been
documented within 1.5 miles of the site ( ery close), another 43 (30 ) between 1.5 and
4 miles (Nearby), and another 39 (27 ) between 4 to 30 miles (In region). Two thirds
(69 ) of the species in Table 2 have been reportedly seen within 4 miles of the project
site. The site therefore supports at least eight special-status species of wildlife, and it
carries the potential for supporting many more special-status species of wildlife based
on the proximities of recorded occurrences. Evidence certainly suggests that habitat
assessments are needed for these species.
MBI (2026) considers the occurrence likelihoods of only 46 (32 ) of the special-status
species listed in Table 2, which means that 97 (6 ) of the special-status species in
Table 2 were screened out of the analysis in the first step of the desktop review. Of the
46 species considered, all but two were determined to be “not expected” to occur on the
project site. Of the species determined to be “not expected,” one of them, Cooper’s hawk,
was observed just off the project site, another 13 species have been documented within
1.5 miles of the project site, and another 12 species have been documented within 4
miles of the project site. In summary, MBI’s occurrence likelihood determinations
comport poorly with the data.
s a a te at on o t e e Commun t
MBI (2026) reports on a field survey and a desktop review having been performed, but
the field survey results are interpreted without any context to survey results from
elsewhere, and the desktop review starts with an inappropriately small pool of special-
status species after misusing the CNDDB. MBI (2026) often resorts to speculation in its
analyses of occurrence likelihoods, having not completed surveys appropriate to bats
and burrowing owls, and having committed too little survey effort overall. Speculated
habitat assessments are highly uncertain, which is inappropriate for precious or rare
resources such as special-status species (National Research Council 19 6). The true
wildlife community remains to be described with sufficient accuracy. Without a more
accurate characteri ation of the wildlife community, the basis is inade uate for
predicting impacts and formulating appropriate mitigation strategies.
At least a fair argument can be made for the need to prepare and EIR to accurately
characteri e the wildlife community of the projects site as a suitable baseline from which
to predict project impacts and to formulate an appropriate mitigation strategy.
FRQW
Page 2-55
Salk Avenue Apartments Project Salk Avenue Apartments Project
Comment Letters and Responses to Comments
Table .Occurrence likelihoods of special status species of wildlife at or near the proposed project site, according to eBird iNaturalist
records https eBird.org, https www.inaturalist.org and on site survey findings, where ery close indicates within 1. miles of the
site, nearby indicates within 1. and miles, and in region indicates within and 30 miles, and in range means the species
geographic range overlaps the site. MSCP cover refers to whether incidental take of the species is covered by the San iego Multiple
Species Conservation Program. ntries in bold font identify species detected by Noriko Smallwood during her site visit.
Common name Species name Status1
SC
ernal pool fairy shrimp Branchinecta lynchi FT In region
San Diego fairy shrimp Branchinecta sandiegonensis FE, CSD1 Yes Not expected In region
Riverside fairy shrimp Streptocephalus woottoni FE Yes Not expected In region
Wandering skipper Pano uina errans CSD1 Nearby
uino checkerspot butterfly uphydryas editha uino FE, CSD1 Yes In region
Monarch anaus plexippus FC, CSD2 Not expected ery close
Crotch’s bumble bee Bombus crotchii CCE Moderate ery close
Western spadefoot Spea hammondii SSC, CSD2 Yes Not expected Nearby
Southwestern pond turtle Actinemys pallida FC, SSC Yes Not expected In region
San Diego banded gecko Coleonyx variegatus abbotti SSC, CSD1 In region
Coast horned lizard Phrynosoma blainvillii SSC, CSD2 Yes Not expected Nearby
Coronado skink Plestiodon skiltonianus
interparietalis
WL, CSD2 Not expected In region
Orange-throated whiptail Aspidoscelis hyperythra WL, CSD2 Yes Not expected In region
Coastal whiptail Aspidoscelis tigris stejnegeri SSC, CSD2 Not expected ery close
San Diegan legless lizard Anniella stebbinsi SSC Not expected Nearby
Coastal rosy boa Lichanura orcutti CSD2 Nearby
California glossy snake Arizona elegans occidentalis SSC, CSD2 Not expected In region
San Diego ringneck snake iadophis punctatus similis CSD2 Nearby
Coast patchnose snake Salvadora hexalepis virgultea SSC, CSD2 Not expected In region
Two-striped gartersnake Thamnophis hammondii SSC, CSD1 Yes Not expected Nearby
South coast garter snake Thamnophis sirtalis pop. 1 SSC, CSD2 Not expected In region
Red diamond rattlesnake Crotalus ruber SSC, CSD2 Yes Not expected ery close
Brant Branta bernicla SSC2 Nearby
Cackling goose (Aleutian)Branta hutchinsii leucopareia WL Nearby
Page 2-56
Salk Avenue Apartments Project Salk Avenue Apartments Project
Comment Letters and Responses to Comments
Common name Species name Status1
SC
Moffitt’s Canada goose Branta canadensis moffitti CSD2 In region
Redhead Aythya americana SSC2, CSD2 ery close
Western grebe Aechmophorus occidentalis BCC, CSD1 Nearby
Clark’s grebe Aechmophorus clarkii BCC Nearby
Western yellow-billed cuckoo Coccyzus americanus occidentalis FT, CE, CSD1 Not expected ery close
Black swift Cypseloides niger SSC3, BCC, CSD2 ery close
aux’s swift Chaetura vauxi SSC ery close
Calliope hummingbird Selasphorus calliope BCC Nearby
Rufous hummingbird Selasphorus rufus BCC ery close
Allen’s hummingbird Selasphorus sasin BCC Present ery close/n
s te
Light-footed Ridgway’s rail allus obsoletus levipes FE, CE, CFP Not expected Nearby
Mountain plover Charadrius montanus SSC2, BCC, CSD2 In region
Snowy plover Charadrius nivosus BCC Nearby
Western snowy plover Charadrius nivosus nivosus FT, SSC Not expected In region
Long-billed curlew Numenius americanus WL, CSD2 Nearby
Marbled godwit Limosa fedoa BCC Nearby
Red knot (Pacific)Calidris canutus BCC Nearby
Short-billed dowitcher Limnodromus griseus BCC Nearby
Willet Tringa semipalmata BCC Nearby
Laughing gull Leucophaeus atricilla WL, CSD2 Nearby
Heermann’s gull Larus heermanni BCC Nearby
Western gull Larus occidentalis BCC ery close
California gull Larus californicus BCC, WL, CSD2 ery close
California least tern Sternula antillarum browni FE, CE, CFP, CSD1 Not expected ery close
Gull-billed tern elochelidon nilotica BCC, SSC3 Nearby
Black tern Chlidonias niger SSC2, BCC, CSD2 Nearby
Elegant tern Thalasseus elegans BCC, WL, CSD1 Nearby
Black skimmer ynchops niger BCC, SSC3, CSD1 Nearby
Common loon avia immer SSC, CSD2 Nearby
FRQW
Page 2-57
Salk Avenue Apartments Project Salk Avenue Apartments Project
Comment Letters and Responses to Comments
Common name Species name Status1
SC
Wood stork Mycteria americana SSC1, CSD2 In region
Brandt’s cormorant rile penicillatus BCC Nearby
Double-crested cormorant Phalacrocorax auritus WL, CSD2 ery close/n
s te
American white pelican Pelacanus erythrorhynchos SSC1, CSD2 ery close
Least bittern Ixobrychus exilis SSC2, CSD2 Not expected Nearby
Great blue heron Ardea herodias CSD2 ery close
Reddish egret gretta rufescens CSD2 Nearby
Green heron Butorides striatus CSD2 ery close
White-faced ibis Plegadis chihi WL, CSD1 Yes Not expected ery close
Turkey vulture Cathartes aura BOP, CSD1 ery close
Osprey Pandion haliaetus WL, BOP, CSD1 Yes ery close
White-tailed kite lanus leucurus CFP, BOP, CSD1 Not expected ery close
Golden eagle A uila chrysaetos BGEPA, BOP, WL,
CFP, CSD1
Yes Not expected In region
Northern harrier Circus cyaneus SSC3, BCC, BOP, CSD1 Yes Not expected ery close
Sharp-shinned hawk Accipiter striatus WL, BOP, CSD1 ery close
Cooper’s hawk Accipiter cooperi WL, BOP, CSD1 Not expected ery
close/ust o
Bald eagle Haliaeetus leucocephalus CE, BGEPA, BOP CSD1 Nearby
Red-shouldered hawk Buteo lineatus BOP, CSD1 ery close/n
s te
Swainson’s hawk Buteo swainsoni CT, BOP, CSD1 Not expected ery close
one-tailed hawk Buteo albonotatus BOP ery close
Red-tailed hawk Buteo jamaicensis BOP Present ery close/n
s te
Ferruginous hawk Buteo regalis BOP, WL, CSD1 Nearby
American barn owl Tyto furcata BOP, CSD2 ery close
Western screech-owl Megascops kennicotti BOP ery close
FRQW
Page 2-58
Salk Avenue Apartments Project Salk Avenue Apartments Project
Comment Letters and Responses to Comments
Common name Species name Status1
SC
Great-horned owl Bubo virginianus BOP ery close
Burrowing owl Athene cunicularia CCE, BCC, SSC2, BOP,
CSD1
Yes Nearby
Long-eared owl Asio otus BCC, BOP, SSC3, CSD1 In region
Short-eared owl Asia flammeus BCC, SSC3, BOP, CSD2 Nearby
Lewis’s woodpecker Melanerpes lewis BCC, CSD1 Nearby
Nuttall’s woodpecker Picoides nuttallii BCC Present ery close/On
site (MB)
American kestrel alco sparverius BOP ery close
Merlin alco columbarius WL, BOP, CSD2 ery close
Peregrine falcon alco peregrinus BOP, CSD1 ery close
Prairie falcon Falco mexicanus WL, BOP, CSD1 In region
Olive-sided flycatcher Contopus cooperi BCC, SSC2, CSD2 ery close
Willow flycatcher mpidonax trailii CE ery close
Southwestern willow flycatcher mpidonax traillii extimus FE, CE Yes Not expected In region
ermilion flycatcher Pyrocephalus rubinus SSC2, CSD1 ery close
Least Bell’s vireo ireo belli pusillus FE, CE, CSD1 Yes Not expected ery close
Loggerhead shrike Lanius ludovicianus SSC2, CSD1 ery close
Oak titmouse Baeolophus inornatus BCC ery close
California horned lark remophila alpestris actia WL, CSD2 ery close
Bank swallow iparia riparia CT, CSD1 Not expected Nearby
Purple martin Progne subis SSC2, CSD1 ery close
Wrentit Chamaea fasciata BCC ery
close/ust o
California gnatcatcher Polioptila c. californica FT, SSC2, CSD1 Yes Present ery close/On
site
(MB)/ust
Clark’s marsh wren Cistothorus palustris clarkae SSC2 In range
FRQW
Page 2-59
Salk Avenue Apartments Project Salk Avenue Apartments Project
Comment Letters and Responses to Comments
Common name Species name Status1
SC
San Diego cactus wren Campylorhynchs brunneicapillus
sandiegensis
SSC1, CSD1 Yes Not expected Nearby
California thrasher Toxostoma redivivum BCC ery close
Western bluebird Sialia mexicana CSD2 ery close
Cassin’s finch Haemorhous cassinii BCC In region
Lawrence’s goldfinch Spinus lawrencei BCC ery close
Grasshopper sparrow Ammodramus savannarum SSC2, CSD1 Yes Nearby
Black-chinned sparrow Spizella atrogularis BCC In region
Bell’s sparrow Amphispiza b. belli WL, CSD1 Yes In region
Oregon vesper sparrow Pooecetes gramineus affinis SSC2 In range
Belding’s savannah sparrow Passerculus sandwichensis beldingi CE, BCC, CSD1 Not expected Nearby
Large-billed savannah sparrow Passerculus sandwichensis rostratus SSC2, CSD2 In region
Southern California rufous-
crowned sparrow
Aimophila ruficeps canescens WL, CSD1 Yes Not expected ery close
Yellow-breasted chat Icteria virens SSC3, CSD1 Yes Not expected ery close
Yellow-headed blackbird anthocephalus xanthocephalus SSC3 ery close
Bullock’s oriole Icterus bullockii BCC ery close
Tricolored blackbird Agelaius tricolor CT, BCC, SSC1, CSD1 Yes Not expected Nearby
Lucy’s warbler Leiothlypis luciae SSC3, CSD1 ery close
irginia’s warbler Leiothlypis virginiae WL, BCC Nearby
Northern yellow warbler Setophaga aestiva SSC2, CSD2 Not expected ery close
Summer tanager Piranga rubra SSC1, CSD2 ery close
Pallid bat Antrozous pallidus SSC, WBWG H, CSD2 Yes Not expected In region
Townsend’s big-eared bat Corynorhinus townsendii SSC, WBWG:H, CSD2 Yes Not expected In region
Spotted bat uderma maculatum SSC, WBWG H, CSD2 In region
California leaf nosed bat Macrotus californicus SSC, WBWG H, CSD2 In region
Western red bat Lasiurus blossevillii SSC, WBWG H, CSD2 In region
Hoary bat Lasiurus cinereus WBWG M Nearby
Western yellow bat Lasiurus xanthinus SSC, WBWG H In region
Small-footed myotis Myotis cililabrum WBWG M, CSD2 In region
FRQW
Page 2-60
Salk Avenue Apartments Project
Comment Letters and Responses to Comments
Salk Avenue Apartments Project
Common name Species name Status1
SC
Long-eared myotis Myotis evotis WBWG M, CSD2 In region
Fringed myotis Myotis thysanodes WBWG H, CSD2 In region
Long-legged myotis Myotis volans WBWG H, CSD2 In region
Yuma myotis Myotis yumanensis WBWG LM, CSD2 Not expected In region
Western mastiff bat umops perotis SSC, WBWG H, CSD2 Not expected In region
Pocketed freeǦtailed bat Nyctinomops femorosaccus SSC, WBWG M, CSD2 Not expected In region
Big free-tailed bat Nyctinomops macrotis SSC, WBWG MH,
CSD2
In region
San Diego black-tailed
jackrabbit
Lepus californicus bennettii SSC, CSD2 Yes In region
Southern grasshopper mouse Onychomys torridus ramona SSC, CSD2 In range
Dulzura pocket mouse Chaetodipus californicus femoralis SSC, CSD2 Not expected In range
Pallid San Diego pocket mouse Chaetodipus fallax pallidus SSC, CSD2 In range
Northwestern San Diego pocket
mouse
Chaetodipus fallax fallax SSC, CSD2 Not expected Nearby
Los Angeles pocket mouse Perognathus longimembris
brevinasus
SSC, CSD2 In range
Stephens’ kangaroo rat ipodomys stephensi FT, CT, CSD1 Yes Not expected In region
San Diego Bryant’s woodrat Neotoma bryanti intermedia SSC, CSD2 Not expected Nearby
1 Listed on CDFW’s Special Animals List (https://nrm.dfg.ca.gov/FileHandler.ashx?DocumentID=109406) as FT or FE = federal
threatened or endangered; FC = federal candidate for listing; CT or CE = California threatened or endangered; CCT or CCE =
Candidate California threatened or endangered; CFP = California Fully Protected (California Fish and Game Code 3 11); SSCi =
California Species of Special Concern with i = priorities 1, 2 and 3; WL = CDFW’s Taxa to Watch List; BGEPA = Bald and Golden
Eagle Protection Act; WBWG = Western Bat Working Group with priority rankings, of low (L), moderate (M), and high (H); BCC =
U.S. Fish and Wildlife Service’s Bird of Conservation Concern (https://www.fws.gov/sites/default/files/documents/birds-of-
conservation-concern-2021.pdf); BOP = protected by Birds of Prey (California Fish and Game Code 3 03. , see
https://wildlife.ca.gov/Conservation/Birds/Raptors); and as CSD1 and CSD2 = Group 1 and Group 2 species on County of San Diego
Sensitive Animal List (County of San Diego 2010).
FRQW
Page 2-61
Comment Letters and Responses to Comments
Salk Avenue Apartments Project
Comment Letters and Responses to Comments
Salk Avenue Apartments Project
I I I TS SSESS E T
The impacts analysis in CEQA review involves prediction. Predictions are necessary
because measuring a project’s impacts directly could not happen until after the impacts
occur, and the timing of this type of measurement would come too late for the
formulations of avoidance and minimi ation mitigation strategies that are prioriti ed by
the CEQA. Impact predictions are necessary as part of the environmental review. The
accuracy of the predictions of impacts and their significance ultimately relies on the
degree of accuracy in the characteri ation of the existing environmental setting (Figure
7).
. eneral flow of information from the gathering stage through the
characteri ation of the e isting en ironment to predictions of impacts and their
significance.
Impact predictions can derive from speculation or from experience (Figure 6).
Speculation is repeatedly discouraged in the CEQA Guidelines, because speculation is an
inconclusive guess or ponderance on a phenomenon without the benefit of data.
Prediction accuracy improves with experience, though the experience that can be
brought to bear on impact predictions ranges from anecdotes to careful use of scientific
inference. Inference is a conclusion derived logically from data that are available about a
phenomenon. Any type of experience is usually better than relying on speculation, but
careful scientific inference, especially inference drawn from experiments, has proven
most effective. An analogy would be predicting the boiling temperature of water at a
certain place with a known atmospheric pressure after having measured it hundreds of
times at other places under various atmospheric pressures. The experience of measuring
the boiling temperature at all these other places would certainly result in a more
accurate prediction of the boiling point as compared to a speculative prediction. We
know that use of inference in this example is certainly more predictive, and not
Assess species occurrence likelihoods
1. Desktop review
a. Species geographic range overlap or database occurrence records
b. Crosswalk habitat associations with mapped ground cover
2. Reconnaissance survey/Habitat assessment
3. Detection surveys for special-status species
Outcomes
5. Predict impacts
6. Formulate mitigation strategy
7. Determine si nificance of impacts
Characterize wildlife community
4. Lists of species detected and of those expected but
not yet detected, and any known trends
Note: Impact predictions and
significance determinations have
been of unknown accuracy in the
absence of experimental
measurement
Page 2-62
Comment Letters and Responses to Comments
Salk Avenue Apartments Project
Comment Letters and Responses to Comments
Salk Avenue Apartments Project
potentially more predictive, because we have a long successful history with the
application of this type of experimentation to draw predictive inference.
The many projects that have undergone CE A review provide a comparative basis for
drawing inferences needed to predict the impacts of the next proposed project (Figure
). Reconnaissance survey results that are not compared to survey results from other
project sites miss the opportunity to interpret the results for the purpose of predicting
impacts. The same is true of CDNNB occurrence records. For example, it would be
helpful to know how often a species lacking CNDDB occurrence records on a site is
nevertheless detected onsite by reconnaissance survey(s). It would be helpful to know
how often the impact predictions of other projects are proven accurate, and how often
the re uired mitigation measures are proven effective. The comparative method enables
the use of scientific inference over speculation and the blind confidence of simply
repeating impact conclusions of unknown accuracy and mitigation strategies of
unknown efficacy.
i e . A framework for arriving at predicted project impacts based on experience
with other project sites. Ideally, there is a pool of similar projects in similar
circumstances where predicted impacts were compared to realized impacts, and into
which the proposed project can also contribute to experience.
In the following, I analyze several types of impacts likely to result from the project, none
of which are analyzed ade uately in the IS/MND, and some of which are not analyzed at
all.
Inference
Project site
Preconstruction
study
Predict
project impacts
Preconstruction
studies
Post-construction
studies
Pool of experience
Post-construction
study
Test predictions
FRQW
Page 2-63
Comment Letters and Responses to Comments
Salk Avenue Apartments Project
Comment Letters and Responses to Comments
Salk Avenue Apartments Project
C C C C SS
Habitat loss results in a reduced productive capacity of affected wildlife species. The site
is proven to serve as habitat to at least 44 species of vertebrate wildlife which Noriko
and MBI observed on the site, but the number of avian nest sites remains unknown. The
surveys that have been conducted on the project site were unsuitable for detecting all
bird nests or estimating total nest density. The alternative method for estimating avian
productive capacity is to infer it from estimates of total nest density elsewhere. Noriko
and I completed studies to estimate total avian nest density in similar environments.
Noriko estimated 1.63 nests/acre in 1.23 acres of sage scrub in Murrieta, California.
Among three of her grassland study sites, one of my grassland study sites, and an
estimate from another grassland (Jorgensen et al. 2014), the average was 3.2 nests/acre.
However, I estimated 21.2 nests/acres at a study site composed of ornamentals grown
in hedges. Applying Noriko’s 1.63 nests/acre to the site’s 0.33 acres of Diegan sage scrub
predicts 0. 4 nests/acre, or a nest every other year. To the 9.4 of the remainder of the
site, I will adjust my average 3.2 nests/acre for the inclusions of ornamentals to estimate
6.4 nests/acre. This density applied to the 9.4 acres of the project site would predict
60. nest sites. Altogether with the Diegan sage scrub, I estimate 61 nest sites on the
project site. Assuming 1.39 broods per nest site based on a review of 322 North
American bird species, which averaged 1.39 broods per year, then I estimate nest
attempts per year on the project site. Assuming Young’s (194 ) study site typifies bird
productivity of 2.9 fledged birds per nest attempt, then I predict 24 fledglings/year at
the project site.
The loss of 61 nest sites and nest attempts per year would ualify as significant
impacts that have not been analyzed in the IS/MND. But the impacts would not end
with the immediate loss of nest sites. The reproductive capacity of the site would be lost.
The project would prevent the production of 24 fledglings per year. Assuming an
average bird generation time of 4 years, the lost capacity of both breeders and annual
fledgling production can be estimated from an e uation in Smallwood (2022):
(nests/year chicks/nest number of years) (2 adults/nest nests/year) (number
of years years/generation) (number of years) = 2 birds per year lost to California.
The loss of 2 birds per year would be a loss of significant habitat value that is
currently provided by the project site. Most if not all these birds are protected by the
federal Migratory Bird Treaty Act and by California’s Migratory Bird Protection Act,
both of which are intended to most strongly protect breeding migratory birds. The loss
of 2 birds per year would easily ualify as an unmitigated significant impact.
N NC N
One of CE A’s principal concerns regarding potential project impacts is whether a
proposed project would interfere with wildlife movement in the region. Unfortunately,
this concern has not motivated any serious analysis of whether or how the project would
Page 2-64
Comment Letters and Responses to Comments
Salk Avenue Apartments Project
Comment Letters and Responses to Comments
Salk Avenue Apartments Project
conclusory statements about how the project site is isolated and lacks vegetative cover of
the sort that would support wildlife movement. No sources are cited in support of the
IS/MND’s conclusions. However, contrary to the IS/MND’s characterization, the project
site is covered by ornamentals, scattered coyote brush (Baccharis pilularis), and
grassland, as well as a patch of Diegan sage scrub. Noriko saw and photographed birds
flying across the site, foraging and collecting nest materials. The isolated nature of the
site only increases its value to migratory wildlife in need of stopover opportunities for
forage, rest and cover. The evidence readily refutes the conclusory statements in the
IS/MND.
The IS/MND also resorts to the red-herring argument that a known wildlife movement
corridor needs to exist before any significant impact can be determined. However, the
CE A standard expressed in uestion (d) of CE A’s App. G Checklist applies to all
types of movement and not just the movement channeled by corridors.
Moreover, MBI (2026) reports no survey objective to detect signs or patterns of wildlife
movement or roosting, and it implemented no study design or program of observation
to characterize wildlife movement or to detect roost sites. No data were collected that
would have supported the IS/MND’s conclusions regarding the site’s value to wildlife
movement or nursery value. The IS/MND’s conclusions are unfounded.
N S C S
Considering national trends, it is safe to assume that house cats would be introduced to
the project area by residents of the proposed residential units. This is significant
because house cats serve as one of the largest sources of avian mortality in North
America (Dauphin and Cooper 2009, Blancher 2013, Loss et al. 2013, Loyd et al. 201 ).
Loss et al. (2013) estimated 139 million cats in the USA in 2013 (range 114 to 164
million), which killed an estimated 16.9 billion vertebrate wildlife annually (range .6
to 26.3 billion). In 2012 there were 0.44 house cats per human in the USA, and 122
vertebrate animals were killed per cat, free-ranging members of which killed
disproportionately larger numbers of vertebrate wildlife. The IS/MND reports no
prediction of the number of new residents in the project, but assuming 2 residents per
apartment unit, then the project can be expected to support 94 new residents. This is
important because Ma and McLeod (2023) found that only 1 of apartment owners
allow their cats to roam free. The above rates of cat ownership applied to numbers of
new residents who would allow their cats to roam free would predict 2 new free-
ranging cats, which based on the findings of Loss et al. (2013) would kill 6,344
vertebrate wildlife per year.
House cats also contribute to downstream loading of Toxoplasma gondii. According to
a UC Davis wildlife health research program, Toxoplasma gondii is a parasite that can
infect virtually all warm blooded animals, but the only known definitive hosts are cats
domesticated and feral house cats included. Cats catch the parasite through hunting
rodents and birds and they offload it into the environment through their feces and
rain that falls on cement creates more runoff than rain that falls on natural earth,
(The
FRQW
Page 2-65
Comment Letters and Responses to Comments
Salk Avenue Apartments Project
Comment Letters and Responses to Comments
Salk Avenue Apartments Project
original link is no longer active, but the uote came from the program described at:
https://whc.vetmed.ucdavis.edu/programs-projects/ca-conservation/sea-otter).
Impacts on wildlife from the introduction of house cats into the environment would be
highly significant, and yet these impacts are not considered in the IS/MND. An obvious
mitigation measure would be to constrain house cat ownership such as re uiring cats to
remain indoors.
N C S N
The IS/MND does not address one of the best-known impacts on wildlife from a
residential project, and that is bird-window collision mortality. The project would
introduce glass windows into an essential portion of avian habitat that portion of the
gaseous atmosphere that is referred to as the aerosphere (Davy et al. 201 , Diehl et al.
201 ). The aerosphere is where birds and bats and other volant animals with wings
migrate, disperse, forage, perform courtship and where some of them mate. Birds are
some of the many types of animals that evolved wings as a morphological adaptation to
thrive by moving through the medium of the aerosphere. The aerosphere is habitat, to
which an entire discipline of ecology has emerged to study this essential aspect of
habitat the discipline of aeroecology (Kunz et al. 200 ).
Many special-status species of birds have been recorded at or near the aerosphere of the
project site. My database review and our site visits indicate there are 101 special-status
species of birds with potential to use the site’s aerosphere (Table 2). All the birds
represented in Table 2 can uickly fly from wherever they have been documented to the
project site, so they would all be within brief flights to the proposed project’s windows.
We confirmed birds of 31 species on the project site, many of them flying across the site.
Window collisions are often characterized as either the second or third largest source or
human-caused bird mortality. The numbers behind these characterizations are often
attributed to Klem’s (1990) and Dunn’s (1993) estimates of about 100 million to 1 billion
bird fatalities in the USA, or more recently by Loss et al.’s (2014) estimate of 36 -9
million bird fatalities in the USA or Calvert et al.’s (2013) and Machtans et al.’s (2013)
estimates of 22.4 million and 2 million bird fatalities in Canada, respectively. The
proposed project would impose windows in the airspace normally used by birds.
Glass-fa ades of buildings intercept and kill many birds, but they are differentially
hazardous to birds based on spatial extent, contiguity, orientation, and other factors. At
Washington State University, Johnson and Hudson (19 6) found 266 bird fatalities of 41
species within 3 months of monitoring of a three-story glass walkway (no fatality
adjustments attempted). Prior to marking the windows to warn birds of the collision
hazard, the collision rate was 4. per year. At that rate, and by not attempting to adjust
the fatality estimate for the proportion of fatalities not found, 4, 4 birds were likely
killed over the 4 years since the start of their study, and that’s at a relatively small
building fa ade. Accounting for the proportion of fatalities not found in searches, the
number of birds killed by this walkway over the last 4 years would have been about
FRQW
Page 2-66
Comment Letters and Responses to Comments
Salk Avenue Apartments Project
Comment Letters and Responses to Comments
Salk Avenue Apartments Project
14,2 0. And this is just for one 3-story, glass-sided walkway between two college campus
buildings.
Klem’s (1990) estimate was based on speculation that 1 to 10 birds are killed per
building per year, and this speculated range was extended to the number of buildings
estimated by the US Census Bureau in 19 6. Klem’s speculation was supported by
fatality monitoring at only two houses, one in Illinois and the other in New York. Also,
the basis of his fatality rate extension has changed greatly since 19 6. Whereas his
estimate served the need to alert the public of the possible magnitude of the bird-
window collision issue, it was highly uncertain at the time and undoubtedly outdated
more than three decades hence. Indeed, by 2010 Klem (2010) characterized the upper
end of his estimated range 1 billion bird fatalities as conservative. Furthermore, the
estimate lumped species together as if all birds are the same and the loss of all birds to
windows has the same level of impact.
By the time Loss et al. (2014) performed their effort to estimate annual USA bird-
window fatalities, many more fatality monitoring studies had been reported or were
underway. Loss et al. (2014) incorporated many more fatality rates based on scientific
monitoring, and they were more careful about which fatality rates to include. However,
they included estimates based on fatality monitoring by homeowners, which in one
study were found to detect only 3 of the available window fatalities (Bracey et al.
2016). Loss et al. (2014) excluded all fatality records lacking a dead bird in hand, such as
injured birds or feather or blood spots on windows. Loss et al.’s (2014) fatality metric
was the number of fatalities per building (where in this context a building can include a
house, low-rise, or high-rise structure), but they assumed that this metric was based on
window collisions. Because most of the bird-window collision studies were limited to
migration seasons, Loss et al. (2014) developed an admittedly assumption-laden
correction factor for making annual estimates. Also, only two of the studies included
adjustments for carcass persistence and searcher detection error, and it was unclear how
and to what degree fatality rates were adjusted for these factors. Although Loss et al.
(2014) attempted to account for some biases as well as for large sources of uncertainty
mostly resulting from an opportunistic rather than systematic sampling data source,
their estimated annual fatality rate across the USA was highly uncertain and vulnerable
to multiple biases, most of which would have resulted in fatality estimates biased low.
In my review of bird-window collision monitoring, I found that the search radius
around homes and buildings was very narrow, usually 2 meters. Based on my experience
with bird collisions in other contexts, I would expect that a large portion of bird-window
collision victims would end up farther than 2 m from the windows, especially when the
windows are higher up on tall buildings. In my experience, searcher detection rates tend
to be low for small birds deposited on ground with vegetation cover or woodchips or
other types of organic matter. Also, vertebrate scavengers entrain on anthropogenic
sources of mortality and uickly remove many of the carcasses, thereby preventing the
fatality searcher from detecting these fatalities. Adjusting fatality rates for these factors
search radius bias, searcher detection error, and carcass persistence rates would
greatly increase nationwide estimates of bird-window collision fatalities.
FRQW
Page 2-67
Comment Letters and Responses to Comments
Salk Avenue Apartments Project
Comment Letters and Responses to Comments
Salk Avenue Apartments Project
Buildings can intercept many nocturnal migrants as well as birds flying in daylight. As
mentioned above, Johnson and Hudson (19 6) found 266 bird fatalities of 41 species
within 3 months of monitoring of a four-story glass walkway at Washington State
University (no adjustments attempted for undetected fatalities). Somerlot (2003) found
21 bird fatalities among 13 buildings on a university campus within only 61 days.
Monitoring twice per week, Hager at al. (200 ) found 21 bird fatalities of 4 species, or
birds/building/year, and at another site they found 142 bird fatalities of 3 species
for 24 birds/building/year. Gelb and Delacretaz (2009) recorded ,400 bird fatalities
under buildings in New York City, based on a decade of monitoring only during
migration periods, and some of the high-rises were associated with hundreds of
fatalities each. Klem et al. (2009) monitored 3 building fa ades in New York City
during 114 days of two migratory periods, tallying 49 collision victims, nearly birds
per day. Borden et al. (2010) surveyed a 1. km route 3 times per week during 12-month
period and found 2 1 bird fatalities of 0 species. Parkins et al. (201 ) found 3 bird
fatalities of 16 species within only 4 days of monitoring under 4 building fa ades. From
24 days of survey over a 4 -day span, Porter and Huang (201 ) found 4 fatalities under
buildings on a university campus. Sabo et al. (2016) found 2 bird fatalities over 61
days of searches under 31 windows. In San Francisco, Kahle et al. (2016) found 3
collision victims within 1,62 days under a -story building. Ocampo-Pe uela et al.
(2016) searched the perimeters of 6 buildings on a university campus, finding 6
fatalities after 63 days of surveys. One of these buildings produced 61 of the 6 fatalities,
and another building with collision-deterrent glass caused only 2 of the fatalities,
thereby indicating a wide range in impacts likely influenced by various factors. There is
ample evidence available to support my prediction that the proposed project would
result in many collision fatalities of birds.
Project Impact Prediction: By the time of these comments, I had reviewed and
processed results of bird collision monitoring at 213 buildings and fa ades for which
bird collisions per m2 of glass per year could be calculated and averaged (Johnson and
Hudson 19 6, O’Connell 2001, Somerlot 2003, Hager et al. 200 , Borden et al. 2010,
Hager et al. 2013, Porter and Huang 201 , Parkins et al. 201 , Kahle et al. 2016,
Ocampo-Pe uela et al. 2016, Sabo et al. 2016, Barton et al. 201 , Gomez-Moreno et al.
201 , Schneider et al. 201 , Loss et al. 2019, Brown et al. 2020, City of Portland Bureau
of Environmental Services and Portland Audubon 2020, Riding et al. 2020). These
study results averaged 0.0 3 bird deaths per m2 of glass per year (9 CI: 0.042-0.102).
This average and its 9 confidence interval provide a robust basis for predicting
fatality rates at a proposed new project.
With the estimated average bird collision mortality above, all that is needed is an
estimate of the spatial extent of windows in the project, but the IS/MND reports no such
metric. However, the IS/MND reports the building would gross 416,1 2 s uare feet of
floor space, and I happen to have maintained an average extent of windows per s uare
foot in other apartment projects. The average was 0.011 m2 of glass window per
s uare foot of floor space, which applied to the s uare footage of the project would
predict 4, 19 m2 of windows in the project. This extent of windows multiplied against
the above-reported average bird collision deaths per m2 of glass per year predicts 3 2
(9 CI: 202 493) bird collision fatalities per year.
FRQW
Page 2-68
Comment Letters and Responses to Comments
Salk Avenue Apartments Project
Comment Letters and Responses to Comments
Salk Avenue Apartments Project
The vast majority of these predicted deaths would be of birds protected under the
Migratory Bird Treaty Act and under the California Migratory Bird Protection Act, thus
causing significant unmitigated impacts that were not addressed in the IS/MND. Given
the predicted level of bird-window collision mortality, and the lack of any proposed
mitigation, it is my opinion that the proposed project would result in potentially
significant adverse biological impacts, including the unmitigated take of both terrestrial
and aerial habitat of birds and other sensitive species. Not only would the project take
habitat of rare and sensitive species of birds, but it would transform the project’s
airspace into a lethal collision trap to birds.
C C S N
The IS/MND neglects to address one of the project’s most obvious, substantial impacts
to wildlife, and that is wildlife mortality and injuries caused by project-generated traffic.
Project-generated traffic would endanger wildlife that must, for various reasons, cross
roads used by the project’s traffic (Photos 23ȸ26), including along roads far from the
project footprint but which would nevertheless by traversed by automobiles head to or
from the project’s building. ehicle collisions have accounted for the deaths of many
thousands of amphibian, reptile, mammal, bird, and arthropod fauna, and the impacts
have often been found to be significant at the population level (Forman et al. 2003).
Across North America traffic impacts have taken devastating tolls on wildlife (Forman et
al. 2003). In Canada, 3, 62 birds were estimated killed per 100 km of road per year
(Bishop and Brogan 2013), and the US estimate of avian mortality on roads is 2,200 to
,40 deaths per 100 km per year, or 9 million to 340 million total per year (Loss et al.
2014). Local impacts can be more intense than nationally.
.A desert cottontail runs across the road just in Murietta, California.Such
road crossings are usually successful, but too often prove fatal to the animal.
FRQW
Page 2-69
Comment Letters and Responses to Comments
Salk Avenue Apartments Project
Comment Letters and Responses to Comments
Salk Avenue Apartments Project
.A great tailed grackle crosses a road in the Imperial alley.
s an . accoon killed on oad 31 just east of Highway 0 in Solano
County left photo taken on 10 November 201 , and California kingsnake killed by a
vehicle on a rural road in l orado County in 202 .
The nearest study of traffic-caused wildlife mortality was performed along a 2. -mile
stretch of asco Road in Contra Costa County, California. Fatality searches in this study
found 1,2 carcasses of 49 species of mammals, birds, amphibians and reptiles over 1
months of searches (Mendelsohn et al. 2009). This fatality number needs to be adjusted
for the proportion of fatalities that were not found due to scavenger removal and
FRQW
Page 2-70
Comment Letters and Responses to Comments
Salk Avenue Apartments Project
Comment Letters and Responses to Comments
Salk Avenue Apartments Project
searcher error. This adjustment is typically made by placing carcasses for searchers to
find (or not find) during their routine periodic fatality searches. This step was not taken
at asco Road (Mendelsohn et al. 2009), but it was taken as part of another study next
to asco Road (Brown et al. 2016). Brown et al.’s (2016) adjustment factors for carcass
persistence resembled those of Santos et al. (2011). Also applying searcher detection
rates from Brown et al. (2016), the adjusted total number of fatalities was estimated at
9,462 animals killed by traffic on the road. This fatality number projected over 1.2
years and 2. miles of road translates to 3,02 wild animals per mile per year. In terms
comparable to the national estimates, the estimates from the Mendelsohn et al. (2009)
study would translate to 1 ,191 animals killed per 100 km of road per year, or 22 times
that of Loss et al.’s (2014) upper bound estimate and 3 times the Canadian estimate.
An analysis is needed of whether increased traffic generated by the project site would
similarly result in local impacts on wildlife.
For wildlife vulnerable to front-end collisions and crushing under tires, road mortality
can be predicted from the study of Mendelsohn et al. (2009) as a basis, although it
would be helpful to have the availability of more studies like that of Mendelsohn et al.
(2009) at additional locations. My analysis of the Mendelsohn et al. (2009) data
resulted in an estimated 3,02 animals killed per mile along a county road in Contra
Costa County. The estimated numbers of fatalities were 1. birds, 26.4 mammals
(many mice and pocket mice, but also ground s uirrels, desert cottontails, striped
skunks, American badgers, raccoons, and others), 6 .4 amphibians (large numbers of
California tiger salamanders and California red-legged frogs, but also Sierran treefrogs,
western toads, arboreal salamanders, slender salamanders and others), and 4.4
reptiles (many western fence lizards, but also skinks, alligator lizards, and snakes of
various species). MT is useful for predicting wildlife mortality because I was able to
uantify miles traveled along the studied reach of asco Road during the period of the
Mendelsohn et al. (2009), hence enabling a rate of fatalities per MT that can be
projected to other sites, assuming similar collision fatality rates.
e t n o e t ene ate t a m a ts on e
The IS/MND fails to report annual MT that would be generated by the project.
However, I have maintained a database of predicted annual MT from other apartment
projects on which I provided expert testimony. The average has been 26 annual MT
per s uare foot of floor space, which applied to the project’s 416,1 2 sf would predict
10, 19,9 2 annual MT would be generated by the project.
During the Mendelsohn et al. (2009) study, 19, 00 cars traveled asco Road in Contra
Costa County daily, so the vehicle miles that contributed to my estimate of non-volant
fatalities was 19, 00 cars and trucks 2. miles 36 days/year 1.2 years =
22,242,1 . vehicle miles per 9,462 wildlife fatalities, or 2,3 1 vehicle miles per fatality.
This rate divided into the predicted annual MT would predict 4,602 vertebrate wildlife
fatalities per year due to project-generated traffic.
However, some might argue that this prediction relies too much on a study along a road
through less-disturbed rangeland that likely supports more non-volant wildlife that is
FRQW
Page 2-71
Comment Letters and Responses to Comments
Salk Avenue Apartments Project
Comment Letters and Responses to Comments
Salk Avenue Apartments Project
more vulnerable to collision mortality. I would argue that the project-generated traffic
would pass through similar rural environments with ample wildlife available to be
crushed under automobile tires. Nevertheless, to better represent those reaches of road
that are more urban than rural, or that would become more urban with the development
of the project, I recently completed my own study of wildlife mortality caused by
automobiles along roads that were urban and interfaced between urban and agricultural
land uses.
I completed one year of daily pedestrian surveys along 2. km (1. 13 miles) of local,
collector and minor arterial roads in north Davis, California, where I tallied 314 fatalities
of 40 species of vertebrate wildlife. Most of the fatalities were small-bodied animals
such as Sierran treefrogs, western toads, western fence lizards, 10 - to 16 -long juvenile
Pacific gophersnakes, valley gartersnakes and California kingsnakes, as well as bushtits,
yellow-rumped warblers, deer mice and California ground s uirrels. Most of the animals
I found would never have been detected from a moving vehicle, which is why people
often underestimate how many wild animals are killed by vehicle traffic.
The animals I found in my study did not include all the animals killed by vehicles on the
roads I searched. Many had been removed by scavengers before I could find and count
them. (American crows patrol the roads every morning, and so does a large flock of wild
turkeys.) Some of the animals are knocked off the road in places where I could never
find them, and some were undoubtedly caught and carried away in the grills of vehicles
or in tire treads. Most of the Sierran treefrogs disappeared from where I found them
within several hours, so daily searches missed many of the fatalities. To adjust for these
undetected fatalities, I fit a logit regression model to my fatality finds, all of which
transitioned to carcass detection trials after I initially found them. Starting with the first
day after each detection, I monitored the carcass trials for 30 days, and I assigned each a
body mass estimate based on typical body mass reported in the literature. Predictor
variables were days since detection and log10 body mass. The relationship between
carcass detection probability and the predictor variables is depicted in Figure 9. My
fatality finds adjusted by the model results in an estimate of 2,126 vertebrate wildlife
fatalities over 1. 13 miles of roads in one year, or 1,241 vertebrate wildlife
fatalities/mile/year. This rate is 40.9 of the rate measured at asco Road, or an
estimated , 4 vehicle miles per fatality. Applying this urban fatality rate to the MT
that is predicted for the project would predict 1, 2 vertebrate wildlife fatalities per year
in the area around the project that is traveled by project-generated traffic.
A reasonable range of predicted mortality is therefore 1, 2 to 4,602 vertebrate wildlife
fatalities/year due to project-generated traffic.
Based on my analysis, the project-generated traffic would cause substantial, significant
impacts on wildlife. The IS/MND does not address this potential impact, let alone
propose to mitigate it. Mitigation measures to improve wildlife safety along roads are
available and are feasible, and they need exploration for their suitability with the
proposed project. Given the predicted level of project-generated traffic-caused
mortality, and the lack of any proposed mitigation, it is my opinion that the proposed
FRQW
Page 2-72
Comment Letters and Responses to Comments
Salk Avenue Apartments Project
Comment Letters and Responses to Comments
Salk Avenue Apartments Project
project would result in potentially significant adverse biological impacts, and that these
impacts would be unmitigated.
i e .
Wildlife
carcass
detection
probability
is a
function of
the number
of days
since
discovery
and log10
body mass.
C C S
One of CE A’s principal concerns regarding potential project impacts is whether a proposed
project would contribute significantly to cumulative impacts of past, present and future projects,
or to multiple types of impacts that are cumulatively considerable. Unfortunately, the IS/MND
fails to analyze the project’s contribution to cumulative impacts on biological resources.
Noriko Smallwood and I performed an experiment to measure the efficacy of permitting
re uirements and re uired mitigation measures at avoiding or minimizing project
impacts including cumulative impacts. We revisited the project sites we had surveyed as
experts to repeat the survey methods at the same time of year, the same start time in the
day, and the same methods and survey duration to control these sources of variation to
cleanly measure the effects of mitigated development on wildlife. We structured the
experiment in a before-after, control-impact experimental design, as some of the sites
had been developed since our initial survey and some had remained undeveloped. All
the developed sites had included mitigation measures to avoid, minimize or compensate
for impacts to wildlife. Nevertheless, we found that mitigated development resulted in a
66 loss of species on site, and 4 loss of species in the project area. Counts of
FRQW
Page 2-73
Comment Letters and Responses to Comments
Salk Avenue Apartments Project
Comment Letters and Responses to Comments
Salk Avenue Apartments Project
vertebrate animals declined 90 . We found that Development impacts measured by
the mean number of species detected per survey were greatest for amphibians (-100 ),
followed by mammals (- 6 ), grassland birds (- ), raptors (- 3 ), special-status
species (-49 ), all birds as a group (-4 ), non-native birds (-44 ), and synanthropic
birds (-2 ). Our results indicated that urban development substantially reduced
vertebrate species richness and numerical abundance, even after richness and
abundance had likely already been depleted by the cumulative effects of loss,
fragmentation, and degradation of habitat in the urbanizing environment, and despite
all the mitigation measures and existing policies, regulations, and habitat plans.
Experimental evidence demonstrates the need to analyze a project’s potentially
significant contributions to cumulative impacts on wildlife. The environmental review
for this project needs to include a cumulative impacts analysis.
N S
The mitigation strategy needs to be based on a sound understanding of the existing
wildlife community. It needs to be known which species occur or are likely to occur on
the project site as well as the nature of their occurrences. Are the occurrences of resident
species? Migratory? For special-status species, detection surveys should have been
performed to either detect the species or to obtain evidence of absence. Surveys should
have been performed to understand how wildlife use the site in their movement
patterns. And what was found of wildlife species needs to be carefully interpreted by
comparing the findings to the findings from other survey efforts at other sites. Failures
to detect species should be interpreted relative to the probabilities of their detections
given the survey effort. The mitigation strategy needs to follow the steps under Assess
species occurrence likelihoods and Characterize wildlife community, followed by Step :
Predict impacts (Figure ). However, the IS/MND’s mitigation strategy does not follow
from these steps. This pointed out, my comments follow in regular font the summary of
each re uired mitigation measure in italics.
1 e ns c i n i S e s i ance an i ica i n. If
construction activities are initiated during the bird nesting season ebruary 1 August
31 involving removal of vegetation or other nesting bird habitat, including abandoned
structures and other man made features, a pre construction nesting bird survey shall
be conducted no more than 1 days prior to initiation of ground disturbance and
vegetation removal activities. ... The survey shall be conducted by a ualified
biologist ... If active nests are found, an avoidance buffer shall be determined by a
ualified biologist in coordination with the City. The avoidance buffer width will
depend upon the species, the proposed work activity, and existing disturbances
associated with land uses outside of the site, which shall be demarcated by the biologist
... No ground disturbing activities shall occur within the buffer until the biologist has
confirmed that breeding nesting is completed, ... A report summarizing the pre
construction survey s shall be submitted to the City prior to the commencement of
construction activities.
If the project goes forward, preconstruction surveys for nesting birds should be
implemented, but this measure would not avoid the permanent loss of habitat nor the
FRQW
Page 2-74
Comment Letters and Responses to Comments
Salk Avenue Apartments Project
Comment Letters and Responses to Comments
Salk Avenue Apartments Project
collision mortality with automobiles. Preconstruction, take-avoidance surveys should
consist of two steps, both of which are very difficult. First, the biologist(s) performing
the survey must identify birds that are breeding. Second, the biologist(s) must locate the
breeding birds’ nests. The first step is typically completed by observing bird behaviors
such as food deliveries and nest territory defense. To be successful, these types of
observations typically re uire many surveys on many dates spread throughout the
breeding season even for a single species. To identify and locate the birds of all species
nesting on a site would re uire a much greater survey effort than can be accomplished in
MM BIO-1’s allotted time. Many bird nests would be missed.
I predict the project site supports 61 nest sites in the average year, and this number does
not include those that would need to be located within the defined buffer area beyond
the project site’s boundary. Even assuming all these nests could be found (not likely),
the mitigation measure would apply only to the breeding season of the survey. After the
breeding season of the preconstruction survey, there would be no further production of
birds from the project site. The project’s impact on birds would be permanent and of
large magnitude. The conservation benefits of this measure would be de minimis
compared to the project’s potential impacts on breeding birds.
Furthermore, the mitigation language allows a single individual to make a subjective
decision, outside the public’s view, to determine the buffer area and buffer timing for
any given species. This measure lacks objective criteria, and it is therefore
unenforceable.
Lastly, the mitigation language includes the re uirement that the preconstruction nest
survey shall be conducted by a ualified biologist, and this re uirement carries over to
determinations of the buffer areas and buffer timing to avoid take caused by
construction activities. Undefined, however, is what ualifies as a “ ualified biologist” in
these contexts, other than familiarity “with the identification of avian species known to
occur in southern California coastal communities.” As mentioned earlier in this letter,
Noriko Smallwood and I have been conducting surveys over the past several years to
estimate total nest density, which is relevant to a preconstruction, take-avoidance
survey because our surveys were likewise directed to all bird species that could be
concurrently nesting on a site. Searching for the nests of one species is difficult, but
searching for nests of all bird species at once is vastly more difficult. For this reason,
there are very few published estimates of total nest density, and there are very few
wildlife biologists who have experience with surveys for the nest attempts of all bird
species on a given site. A technical way to ualify a wildlife biologist for the tasks
outlined in this measure would be to obtain an agency Memorandum of Understanding
in which the biologist is named and said to be ualified for conducting the
preconstruction survey and for determining the take-avoidance buffer area and timing.
However, a more compelling means of ualifying the biologist would be to re uire that
the biologist has achieved demonstrable experience with nest surveys and avian nesting
behavior. Without a better definition of what is a ualified biologist in the contexts of
these tasks, BIO-1 lacks objective criteria, and it is therefore unenforceable.
FRQW
Page 2-75
Comment Letters and Responses to Comments
Salk Avenue Apartments Project
Comment Letters and Responses to Comments
Salk Avenue Apartments Project
ot h s o dan and a an
hree on-site sur eys for rotch’s bumble bee ( ) shall be conducted prior to
initiation of ground disturbing project acti ities to identify if the is present within
the project site.
MM BIO-1 is inappropriate because it defers the appropriate detection survey to a time
when it would no longer achieve four of CEQA’s primary objectives to (1) accurately
characteri e the existing environmental setting as part of the CEQA review, (2) disclose
potential project impacts to the public and decision-makers, and (3) foster public
participation with decision-making over proposed projects to (4) identify issues and
feasible alternative mitigation measures to minimi e environmental impacts. The
appropriate timing of the survey is essential, not just biologically but also in terms of
achieving CEQA’s objectives. According to CDFW (2023:3), “On-site surveys provide the
most valuable information for determining potential impacts of proposed projects and
activities on the four candidate bumble bee species, and subse uently developing
measures to avoid or minimi e take of these species.” This guidance obviously
recogni es the need to complete the detection surveys before the public circulation of
the CEQA review document; otherwise, it would not be possible to determine potential
impacts or formulate appropriate mitigation.
Crotch’s bumble bee is a candidate for listing under the California Endangered Species
Act. It is therefore important to implement the appropriate detection survey, which
should be consistent with CDFW (2023).
Furthermore, I found no evidence in the IS/MND that efforts have been made to obtain
an incidental take permit (ITP), nor that CDFW is inclined to issue and ITP for Crotch’s
bumble bee in this project.
EE E ITI TI E S ES
The project would destroy the productive
capacity of the project site for birds and other wildlife. The loss of this capacity would
need to be offset by compensatory mitigation as near to the site as possible. I
recommend a 5:1 mitigation ratio to achieve a no net loss standard, as a 1:1 ratio would
simply ensure a 50 loss of habitat between the project site and mitigation site.
The loss of burrowing owl foraging opportunities would need to be mitigated, as well.
The applicant needs to consult with the CDFW to learn what mitigation ratio would be
acceptable for loss of burrowing owl habitat on the project site, and whether and where
habitat is available to be protected nearby.
If the project goes forward, it should at a
minimum adhere to available Bird-Safe Guidelines, such as those prepared by American
Bird Conservancy and New ork and San Francisco. The American Bird Conservancy
(ABC) produced an excellent set of guidelines recommending actions to: (1) Minimi e
use of glass; (2) Placing glass behind some type of screening (grilles, shutters, exterior
shades); (3) Using glass with inherent properties to reduce collisions, such as patterns,
FRQW
Page 2-76
Comment Letters and Responses to Comments
Salk Avenue Apartments Project
Comment Letters and Responses to Comments
Salk Avenue Apartments Project
window films, decals or tape; and (4) Turning off lights during migration seasons
(Sheppard and Phillips 2015). The City of San Francisco (San Francisco Planning
Department 2011) also has a set of building design guidelines, based on the excellent
guidelines produced by the New ork City Audubon Society (Orff et al. 2007). The ABC
document and both the New ork and San Francisco documents provide excellent
alerting of potential bird-collision ha ards as well as many visual examples. The San
Francisco Planning Department’s (2011) building design guidelines are more
comprehensive than those of New ork City, but they could have gone further. For
example, the San Francisco guidelines probably should have also covered scientific
monitoring of impacts as well as compensatory mitigation for impacts that could not be
avoided, minimi ed or reduced.
New research results inform of the efficacy of marking windows. Whereas lem (1990)
found no deterrent effect from decals on windows, ohnson and Hudson (1976) reported
a fatality reduction of about 69 after placing decals on windows. In an experiment of
opportunity, Ocampo-Pe uela et al. (2016) found only 2 of 6 fatalities at one of 6
buildings the only building with windows treated with a bird deterrent film. At the
building with fritted glass, bird collisions were 2 lower than at other buildings with
untreated windows. ahle et al. (2016) added external window shades to some
windowed fa ades to reduce fatalities 2 and 95 . Brown et al. (2020) reported an
4 lower collision probability among fritted glass windows and windows treated with
ORNILU R U . City of Portland Bureau of Environmental Services and Portland
Audubon (2020) reduced bird collision fatalities 94 by affixing marked Solyx window
film to existing glass panels of Portland’s Columbia Building. Many external and
internal glass markers have been tested experimentally, some showing no effect and
some showing strong deterrent effects ( lem 19 9, 1990, 2009, 2011; lem and Saenger
2013; R ssler et al. 2015). For example, Feather Friendly circular adhesive markers
applied in a grid pattern across all windows reduced bird-window collision mortality by
95 in one study (Riggs et al. 2023) and by 95 in another (de Groot et al. 2021).
Another study tested the efficacy of two filmshades to be applied exteriorly to windows
prior to installations: BirdShades increased bird-window avoidance by 47 and
Haverkamp increased avoidance by 39 (Swaddle et al. 2023).
Compensatory mitigation is needed for the increased wildlife
mortality that would be caused by collisions with automobiles due to project-generated
road traffic in the region. I suggest that this mitigation can be directed toward funding
research to identify fatality patterns and effective impact reduction measures such as
reduced speed limits and wildlife under-crossings or overcrossings of particularly
dangerous road segments. Compensatory mitigation can also be provided in the form of
donations to wildlife rehabilitation facilities (see below).
Compensatory mitigation is needed, and
it ought to also include funding contributions to wildlife rehabilitation facilities to cover
the costs of injured animals that will be delivered to these facilities for care. Many
animals would likely be injured during construction, by house cats, and by collisions
with windows and with automobiles traveling to and from the project site.
FRQW
Page 2-77
Comment Letters and Responses to Comments
Salk Avenue Apartments Project
Comment Letters and Responses to Comments
Salk Avenue Apartments Project
If the project goes forward, California native plant landscaping (i.e.,
grassland and locally appropriate scrub plants) should be considered to be used as
opposed to landscaping with lawn and exotic shrubs and trees. Native plants offer more
structure, cover, food resources, and nesting substrate for wildlife than landscaping with
lawn and ornamental trees. Native plant landscaping has been shown to increase the
abundance of arthropods which act as important sources of food for wildlife and are
crucial for pollination and plant reproduction (Narango et al. 2017, Adams et al. 2020,
Smallwood and Wood 2022.). Further, many endangered and threatened insects re uire
native host plants for reproduction and migration, e.g., monarch butterfly. Around the
world, landscaping with native plants over exotic plants increases the abundance and
diversity of birds, and it is particularly valuable to native birds (Lerman and Warren
2011, Burghardt et al. 200 , Berthon et al. 2021, Smallwood and Wood 2022).
Landscaping with native plants is a way to maintain or to bring back some of the natural
habitat and lessen the footprint of urbani ation by acting as interconnected patches of
habitat for wildlife (Goddard et al. 2009, Tallamy 2020). Lastly, not only does native
plant landscaping benefit wildlife, it re uires less water and maintenance than
traditional landscaping with lawn and hedges.
Thank you for your consideration,
Shawn Smallwood, Ph.D.
ITE T E ITE
Adams, B. ., E. Li, C. A. Bahlai, E. . Meineke, T. P. McGlynn, and B. . Brown. 2020.
Local and landscape-scale variables shape insect diversity in an urban biodiversity
hot spot. Ecological Applications 30(4):e020 9. 10.1002/eap.20 9
Barton, C. M., C. S. Riding, and S. R. Loss. 2017. Magnitude and correlates of bird
collisions at glass bus shelters in an urban landscape. Plos One 12. (6): e017 667.
https://doi.org/10.1371/journal.pone.017 667
Berthon, ., F. Thomas, and S. Bekessy. 2021. The role of nativenes’ in urban greening
to support animal biodiversity. Landscape and Urban Planning 205:103959.
https://doi.org/10.1016/j.landurbplan.2020.103959
Bishop, C. A. and . M. Brogan. 2013. Estimates of avian mortality attributed to vehicle
collisions in Canada. Avian Conservation and Ecology :2.
http://dx.doi.org/10.5751/ACE-00604-0 0202.
Blancher, P. 2013. Estimated number of birds killed by house cats (elis catus) in
Canada. Avian Conservation and Ecology (2): 3. http://dx.doi.org/10.5751/ACE-
00557-0 0203
FRQW
Page 2-78
Comment Letters and Responses to Comments
Salk Avenue Apartments Project
Comment Letters and Responses to Comments
Salk Avenue Apartments Project
Borden, W. C., O. M. Lockhart, A. W. ones, and M. S. Lyons. 2010. Seasonal,
taxonomic, and local habitat components of bird-window collisions on an urban
university campus in Cleveland, OH. Ohio ournal of Science 110(3):44-52.
Bracey, A. M., M. A. Etterson, G. . Niemi, and R. F. Green. 2016. ariation in bird-
window collision mortality and scavenging rates within an urban landscape. The
Wilson ournal of Ornithology 12 :355-367.
Brown, B. B., L. Hunter, and S. Santos. 2020. Bird-window collisions: different fall and
winter risk and protective factors. Peer :e9401 http://doi.org/10.7717/peerj.9401
Brown, ., . S. Smallwood, . S ewc ak, and B. aras. 2016. Final 2012-2015 Report
Avian and Bat Monitoring Project asco Winds, LLC. Prepared for NextEra Energy
Resources, Livermore, California.
Burghardt, . T., D. W. Tallamy, and W. G. Shriver. 200 . Impact of native plants on
bird and butterfly biodiversity in suburban landscapes. Conservation Biology 23:219-
224.
CDFW (California Department of Fish and Wildlife). 2012. Staff report on burrowing
owl mitigation. Sacramento, California.
CDFW (California Department of Fish and Wildlife). 201 . Protocols for surveying and
evaluating impacts to special status native plant populations and sensitive natural
communities. https://nrm.dfg.ca.go
CDFW (California Department of Fish and Wildlife). 2023. Survey Considerations for
California Endangered Species Act (CESA) Candidate Bumble Bee Species.
Calvert, A. M., C. A. Bishop, R. D. Elliot, E. A. rebs, T. M. ydd, C. S. Machtans, and G.
. Robertson. 2013. A synthesis of human-related avian mortality in Canada. Avian
Conservation and Ecology (2): 11. http://dx.doi.org/10.5751/ACE-005 1-0 0211
City of Portland Bureau of Environmental Services and Portland Audubon. 2020.
Collisions at the Columbia Building: A synthesis of pre- and post-retrofit monitoring.
Environmental Services of City of Portland, Oregon.
County of San Diego. 2010. County of San Diego guidelines for determining
significance and report format and content re uirements biological resources. Land
Use and Environment Group Department of Planning and Land Use Department of
Public Works, Fourth Revision.
Dauphin , N. and R. . Cooper. 2009. Impacts of free-ranging domestic cats (elis
catus) on birds in the United States: a review of recent research with conservation
and management recommendations. Pages 205-219 in T. D. Rich, C. Ari mendi, D.
W. Demarest, and C. Thompson, eds., Proceedings of the Fourth International
Partners in Flight Conference: Tundra to Tropics.
Page 2-79
Comment Letters and Responses to Comments
Salk Avenue Apartments Project
Comment Letters and Responses to Comments
Salk Avenue Apartments Project
Davy, C. M., A. T. Ford, and . C. Fraser. 2017. Aeroconservation for the fragmented
skies. Conservation Letters 10(6): 773 7 0.
Diehl, R. H., A. C. Peterson, R. T. Bolus, and D. ohnson. 2017. Extending the habitat
concept to the airspace. USGS Staff -- Published Research. 1129.
https://digitalcommons.unl.edu/usgsstaffpub/1129
Dunn, E. H. 1993. Bird mortality from striking residential windows in winter. ournal of
Field Ornithology 64:302-309.
Forman, T. T., D. Sperling, . A. Bisonette, A. P. Clevenger, C. D. Cutshall, . H. Dale, L.
Fahrig, R. France, C. R. Goldman, . Heanue, . A. ones, F. . Swanson, T.
Turrentine, and T. C. Winter. 2003. Road Ecology. Island Press, Covello, California.
Gelb, . and N. Delacreta . 2009. Windows and vegetation: Primary factors in
Manhattan bird collisions. Northeastern Naturalist 16:455-470.
Goddard, M. A., A. . Dougill, and T. G. Benton. 2009. Scaling up from gardens:
biodiversity conservation in urban environments. Trends in Ecology and Evolution
25:90-9 . doi:10.1016/j.tree.2009.07.016
G me -Moreno, . del C., . R. Herrera-Herrera, and S. Ni o-Maldonado. 201 . Bird
collisions in windows of Centro Universitario ictoria, Tamaulipas, M xico. Huit il,
Revista Mexicana de Ornitolog a 19(2): 227-236. https://doi.org/10.2 947/
hrmo.201 .19.2.347
De Groot, . L., A. G. Wilson, R. Mc ibbin, S. A. Hudson, . M. Dohms, A. R. Norris, A.
C. Huang, I. B. . Whitehorne, . T. Fort, C. Roy, . Bour ue, and S. Wilson. 2022.
Bird protection treatments reduce bird-window collision risk at low-rise buildings
within a Pacific coastal protected area. Peer 10(9):e13142 DOI 10.7717/peerj.13142.
Hager, S. B., H. Trudell, . . Mc ay, S. M. Crandall, and L. Mayer. 200 . Bird density
and mortality at windows. Wilson ournal of Ornithology 120:550-564.
Hager S. B., B. . Cosentino, . Mc ay, C. Monson, W. uurdeeg, and B. Blevins. 2013.
Window area and development drive spatial variation in bird-window collisions in
an urban landscape. PLoS ONE (1): e53371. doi:10.1371/journal.pone.0053371
Hall, L. S., P. R. rausman, and M. L. Morrison. 1997. The habitat concept and a plea for
standard terminology. Wildlife Society Bulletin 25:173- 2.
ohnson, R. E., and G. E. Hudson. 1976. Bird mortality at a glassed-in walkway in
Washington State. Western Birds 7:99-107.
orgensen, . G., L. R. Dinan, M. A. Brogie, W. R. Silcock, . Rink, C. laphake, and G.
Steinauer. 2014. Breeding bird diversity, abundance and density at Indian Cave and
Page 2-80
Comment Letters and Responses to Comments
Salk Avenue Apartments Project
Comment Letters and Responses to Comments
Salk Avenue Apartments Project
Ponca State Parks, Nebraska 2012-2014. Nongame Bird Program of the Nebraska
Game and Parks Commission. Lincoln, NE.
ahle, L. Q., M. E. Flannery, and . P. Dumbacher. 2016. Bird-window collisions at a
west-coast urban park museum: analyses of bird biology and window attributes from
Golden Gate Park, San Francisco. PLoS ONE 11(1):e144600 DOI
10.1371/journal.pone.0144600.
lem, D., r. 1990. Collisions between birds and windows: mortality and prevention.
ournal of Field Ornithology 61:120-12 .
lem, D., r. 19 9. Bird-window collisions. Wilson Bulletin 101:606-620.
lem, D., r. 2009. Preventing bird-window collisions. The Wilson ournal of
Ornithology 121:314-321.
lem, D., r. 2010. Avian mortality at windows: the second largest human source of
bird mortality on earth. Pages 244-251 in Proc. Fourth Int. Partners in Flight
Conference: Tundra to Tropics.
lem, D., r. 2011. Evaluating the effectiveness of Acopian Birdsavers to deter or
prevent bird-glass collisions. Unpublished report.
lem, D., r. and P. G. Saenger. 2013. Evaluating the effectiveness of select visual
signals to prevent bird-window collisions. The Wilson ournal of Ornithology
125:406 411.
un , T. H., S. A. Gauthreaux r., N. I. Hristov, . W. Horn, G. ones, E. . . alko, R.
P. Larkin, G. F. McCracken, S. M. Swart , R. B. Srygley, R. Dudley, . . Westbrook,
and M. Wikelski. 200 . Aeroecology: probing and modelling the aerosphere.
Integrative and Comparative Biology 4 :1-11. doi:10.1093/icb/icn037
Lerman, S. B. and P. S. Warren. 2011. The conservation value of residential yards:
linking birds and people. Ecological Applications 21:1327-1339.
Loss, S. R., T. Will, and P. P. Marra. 2013. The impact of free-ranging domestic cats on
wildlife of the United States. Nature Communications 23 0. DOI:
10.103 /ncomms23 0
Loss, S. R., T. Will, and P. P. Marra. 2014. Estimation of bird-vehicle collision mortality
on U.S. roads. ournal of Wildlife Management 7 :763-771.
Loss, S. R., T. Will, and P. P. Marra. 2014. Estimation of bird-vehicle collision mortality
on U.S. roads. ournal of Wildlife Management 7 :763-771.
Page 2-81
Comment Letters and Responses to Comments
Salk Avenue Apartments Project
Comment Letters and Responses to Comments
Salk Avenue Apartments Project
Loss, S. R., T. Will, S. S. Loss, and P. P. Marra. 2014. Bird building collisions in the
United States: Estimates of annual mortality and species vulnerability. The Condor:
Ornithological Applications 116:-23. DOI: 10.1650/CONDOR-13-090.1
Loss, S. R., S. Lao, . W. Eckles, A. W. Anderson, R. B. Blair, and R. . Turner. 2019.
Factors influencing bird-building collisions in the downtown area of a major North
American city. PLoS ONE 14(11): e0224164. https://doi.org/10.1371/journal.
pone.0224164
Loyd, . A. T., S. M. Hernande , and D. L. McRuer. 2017. The role of domestic cats in
the admission of injured wildlife at rehabilitation and rescue centers. Wildlife
Society Bulletin 41:55-61.
Machtans, C. S., C. H. R. Wedeles, and E. M. Bayne. 2013. A first estimate for Canada of
the number of birds killed by colliding with building windows. Avian Conservation
and Ecology (2):6. http://dx.doi.org/10.5751/ACE-0056 -0 0206
Mendelsohn, M., W. Dexter, E. Olson, and S. Weber. 2009. asco Road wildlife
movement study report. Report to Contra Costa County Public Works Department,
Martine , California.
MBI (Michael Baker International). 2026. Biological Resources Technical Letter Report
for the Salk Avenue Apartments Project in Carlsbad, San Diego County, California.
Letter report to oe Gambill, Hanover Company, Los Angeles, California.
Miller, . 2024. Petition Before the California Fish and Game Commission to list
California populations of the Western Burrowing Owl (Athene cunicularia
hypugaea) as Endangered or Threatened Under the California Endangered Species
Act. Center for Biological Diversity, Defenders of Wildlife, Burrowing Owl
Preservation Society, Santa Clara alley Audubon Society, Urban Bird Foundation,
Central alley Bird Club, San Bernardino alley Audubon Society.
Narango, D. L., D. W. Tallamy, and P. P. Marra. 2017. Native plants improve breeding
and foraging habitat for an insectivorous bird. Biological Conservation 213:42-50.
National Research Council. 19 6. Ecological knowledge and environmental problem-
solving: concepts and case studies. National Academy Press, Washington, D.C.
Ocampo-Pe uela, N., R. S. Winton, C. . Wu, E. ambello, T. W. Wittig and N. L. Cagle .
2016. Patterns of bird-window collisions inform mitigation on a university campus.
Peer 4:e1652;DOI10.7717/peerj.1652
O’Connell, T. . 2001. Avian window strike mortality at a suburban office park. The
Raven 72:141-149.
Orff, ., H. Brown, S. Caputo, E. . McAdams, M. Fowle, G. Phillips, C. DeWitt, and .
Gelb. 2007. Bird-safe buildings guidelines. New ork City Audubon, New ork.
Page 2-82
Comment Letters and Responses to Comments
Salk Avenue Apartments Project
Comment Letters and Responses to Comments
Salk Avenue Apartments Project
Parkins, . L., S. B. Elbin, and E. Barnes. 2015. Light, glass, and bird building collisions
in an urban park. Northeastern Naturalist 22: 4-94.
Porter, A., and A. Huang. 2015. Bird collisions with glass: UBC pilot project to assess
bird collision rates in Western North America. UBC Social Ecological Economic
Development Studies (SEEDS) Student Report. Report to Environment Canada,
UBC SEEDS and UBC BRITE.
Riding, C. S., T. . O’Connell, and S. R. Loss. 2020. Building fa ade-level correlates of
bird window collisions in a small urban area. The Condor: Ornithological
Applications 122:1 14.
Riggs, G. ., C. M. Barton, C. S. Riding, T. . O’Connell1, and S. R. Loss. 2023.
FieldǦtesting effectiveness of window markers in reducing birdǦwindow collisions.
Urban Ecosystems (2023) 26:713 723. https://doi.org/10.1007/s11252-022-01304-
w
R ssler, M., E. Nemeth, and A. Bruckner. 2015. Glass pane markings to prevent bird-
window collisions: less can be more. Biologia 70: 535 541. DOI: 10.1515/biolog-
2015-0057
Rosenberg, . ., A. M. Dokter, P. . Blancher, . R. Sauer, A. C. Smith, P. A. Smith, . C.
Stanton, A. Panjabi , L. Helft , M. Parr, and P. P. Marra. 2019. Decline of the North
American avifauna. Science 10.1126/science.aaw1313 (2019).
Sabo, A. M., N. D. G. Hagemeyer, A. S. Lahey, and E. L. Walters. 2016. Local avian
GHQVLW\LQÀXHQFHVULVNRIPRUWDOLW\IURPZLQGRZVWULNHV3HHU-H'2,
10.7717/peerj.2170
San Francisco Planning Department. 2011. Standards for bird-safe buildings. San
Francisco Planning Department, City and County of San Francisco, California.
Santos, S. M., F. Carvalho, and A. Mira. 2011. How long do the dead survive on the road?
Carcass persistence probability and implications for road-kill monitoring surveys.
PLoS ONE 6(9): e253 3. doi:10.1371/journal.pone.00253 3
Schneider, R. M., C. M. Barton, . W. irkle, C. F. Greene, and . B. Newman. 201 .
ear-round monitoring reveals prevalence of fatal bird-window collisions at the
irginia Tech Corporate Research Center. Peer 6:e4562 https://doi.org/10.7717/
peerj.4562
Smallwood, .S. 2002. Habitat models based on numerical comparisons. Pages 3-95 in
Predicting species occurrences: Issues of scale and accuracy, . M. Scott, P. .
Heglund, M. Morrison, M. Raphael, . Haufler, and B. Wall, editors. Island Press,
Covello, California.
Page 2-83
Comment Letters and Responses to Comments
Salk Avenue Apartments Project
Comment Letters and Responses to Comments
Salk Avenue Apartments Project
Smallwood, . S. 2015. Habitat fragmentation and corridors. Pages 4-101 in M. L.
Morrison and H. A. Mathewson, Eds., Wildlife habitat conservation: concepts,
challenges, and solutions. ohn Hopkins University Press, Baltimore, Maryland,
USA.
Smallwood, . S. 2022. Utility-scale solar impacts to volant wildlife. ournal of Wildlife
Management: e22216. https://doi.org/10.1002/jwmg.22216
Smallwood, . S., and N. L. Smallwood. 2023. Measured effects of anthropogenic
development on vertebrate wildlife diversity. Diversity 15, 1037.
https://doi.org/10.3390/d15101037.
Smallwood, N. L. and E. M. Wood. 2022. The ecological role of native plant landscaping
in residential yards to urban wildlife. Ecosphere 2022;e4360.
Somerlot, . E. 2003. Survey of songbird mortality due to window collisions on the
Murray State University campus. ournal of Service Learning in Conservation
Biology 1:1 19.
Swaddle, . P., B. Brewster, M. Schuyler, and A. Su. 2023. Window films increase
avoidance of collisions by birds but only when applied to external compared with
internal surfaces of windows. Peer 11:e14676 http://doi.org/10.7717/peerj.14676
Tallamy, D.W. 2020. Nature’s Best Hope: A New Approach to Conservation that Starts
in our ard. Timber Press.
Wood, E. M., and S. Esaian. 2020. The importance of street trees to urban avifauna.
Ecological Applications. 0:e02149.
oung, H. 194 . A comparative study of nesting birds in a five-acre park. The Wilson
Bulletin 61:36-47.
Page 2-84
Comment Letters and Responses to Comments
Salk Avenue Apartments Project Page 2-85
Responses to Comments from Lozeau Drury LLP on behalf of the Supporters Alliance for
Environmental Responsibility (SAFER)
Response to Comment 2-1
The comment summarizes the CEQA “fair argument” standard and legal requirements for
preparing an EIR versus an MND. The City acknowledges and has complied with these standards.
In this case, a Focused IS/MND was prepared because all potential impacts to biological
resources were found to be less than significant with mitigation. The City carefully evaluated the
whole record and determined that no substantial evidence supported a fair argument of
unmitigated significant impacts. On the contrary, the letter from Dr. Smallwood and the report
prepared by Ms. Smallwood rely on speculative analysis and unsupported extrapolation, which
substantially overstate the project’s potential impacts to biological resources. The following
Responses to Comments 2-2 through 2-24 provide substantial evidence that the project’s
biological resources impacts have been fully analyzed and mitigated to less than significant
consistent with CEQA requirements.
Response to Comment 2-2
The project-specific Biological Resources Technical Letter Report provided a comprehensive
approach and included a literature/database review (California Natural Data Diversity Database
[CNDDB], US Fish and Wildlife Service [USFWS] Information for Planning and Consultation,
California Native Plant Society, etc.), a site visit by qualified biologists in January 2026, and
consideration of previous biological surveys from 2001–2003. This effort identified all sensitive
biological resources with potential to occur on-site (including coastal California gnatcatcher,
Crotch’s bumble bee, and thread-leaved brodiaea) and determined that other special-status
species were unlikely to occur due to the absence of suitable habitat (e.g., no wetlands, vernal
pools, or extensive native vegetation) or other environmental constraints. The commenter’s March
11, 2026 site survey by Ms. Smallwood recorded additional common wildlife species, primarily
birds such as hummingbirds, sparrows, and crows, which are typical of the region’s urban-edge
habitats and were not individually listed in the IS/MND but were generally acknowledged in the
description of the site’s wildlife community. These additional observations do not indicate that the
IS/MND overlooked any previously unknown significant resource; rather, they reflect common
wildlife species acclimated to an urban environment. Crucially, all species of concern for CEQA
purposes (e.g., those that could trigger significant impacts) were duly considered in the IS/MND.
The City stands by the adequacy of the environmental setting description in the IS/MND, which
meets CEQA Guidelines Section 15063(d) requirements by focusing on the physical biological
conditions relevant to assessing significant impacts. The commenter’s broad claim that the site
supports numerous special-status species is not supported by substantial evidence of suitable
habitat or direct observations beyond those already addressed. In summary, the City finds that
the IS/MND and supporting biological resources technical report properly identified the presence
and potential of special-status species on-site and that it provided an accurate baseline for impact
analysis. No species likely to be significantly impacted by the project were omitted.
Response to Comment 2-3
The City has considered whether the project’s biological resources impacts could be significant,
including those listed by the commenter. For each category habitat loss and nesting productivity,
wildlife movement, predation by pets, bird-window collisions, vehicle-related mortality, and
Comment Letters and Responses to Comments
Salk Avenue Apartments Project Page 2-86
cumulative effects the IS/MND provides analysis and, where necessary, identifies appropriate
mitigation measures. As detailed in Responses to Comments 2-4 through 2-8 below, the City’s
analysis concludes that these impacts would be reduced to less than significant with mitigation
incorporated. MM BIO-1 (Pre-Construction Nesting Bird Surveys, Avoidance, and Notification)
establishes clear performance standards to avoid and minimize indirect impacts to gnatcatchers,
including protection of active nests and limitation of construction-related disturbance. The
mitigation measure requires installation of a no-disturbance buffer around any active gnatcatcher
nest identified by a qualified biologist and implementation of construction controls to ensure
disturbance levels remain below thresholds that could adversely affect nesting behavior. It is
noted that clarification related to the coastal California gnatcatcher was made to MM BIO-1 (refer
to Response to Comment 2-23 for revisions). See also Response to Comment 2-17.
MM BIO-2 (Crotch’s Bumble Bee Avoidance and Clearance Survey) would ensure that Crotch’s
bumble bee focused surveys would occur on-site at the appropriate time of year (during the
flowering/active season) prior to any ground disturbance, when detection is most likely.
Subsequent to release of the IS/MND for public review, a site-specific three-survey protocol
design was approved by CDFW. The three subsequent surveys were conducted in April and May
2026. Crotch’s bumble bee was not detected in any of the three surveys and the negative findings
were reported to CDFW. The commenter’s assertions that the project would result in loss of 61
bird nesting sites and 85 nesting attempts per year, as well as prevention of the production of 247
fledglings and 278 birds per year are not supported by substantial evidence and are therefore
speculative (CEQA Guidelines Sections 15064[d][3] and 15145). The project would convert
approximately 9.5 acres of previously graded, routinely mowed disturbed habitat. This would not
substantially reduce local wildlife populations or bird reproductive capacity. The only on-site native
habitat (a 0.33-acre Diegan coastal sage scrub patch with potential gnatcatcher foraging value)
would be avoided and preserved as open space. The remaining habitat is of low quality and
supports common, regionally abundant species. Project compliance with Migratory Bird Treaty
Act and California Fish and Game Code requirements would be ensured through MM BIO-1 (pre-
construction nesting bird surveys and avoidance buffers). With implementation of MM BIO-1 and
existing regional conservation/Citywide coverage (via the City’s HMP3), project impacts from
habitat removal would be less than significant and an EIR is not warranted.
Response to Comment 2-4
The project site is an isolated, disturbed infill parcel surrounded by existing roadways and
development and is not identified as a designated wildlife corridor or linkage in regional plans
(including the HMP, which clearly calls out wildlife corridors in the City). Existing barriers (e.g.,
Salk Avenue) currently limit wildlife movement through the area. The on-site Diegan coastal sage
scrub patch may provide minor bird stopover value; such habitat would be avoided and preserved
as open space with project implementation. The project would not add new major barriers across
natural open space. Further, there is ample alternative stopover habitat in the area for migratory
birds. Project conformance with applicable HMP Adjacency Standards (directed lighting,
construction noise controls, and pet management) would also ensure that the project would not
substantially interfere with area wildlife movement. Impacts would be less than significant. Refer
3 City of Carlsbad. Habitat Management Plan for Natural Communities in the City of Carlsbad. Final approved December 1999; as
amended and approved November 2004.
https://www.carlsbadca.gov/home/showpublisheddocument/1600/638366818940500000.
Comment Letters and Responses to Comments
Salk Avenue Apartments Project Page 2-87
also to Responses to Comments 1-10 and 2-18 for additional discussion of habitat connectivity
and fragmentation.
Response to Comment 2-5
The project is subject to the City’s HMP Adjacency Guidelines which require pet/predator control
measures. In compliance with these standards, the project would include: (1) resident education
that provides all tenants with information on the ecological importance of keeping cats indoors or
supervised (e.g., through community guidelines prohibiting free-roaming cats and lease
provisions such as outdoor leash requirements), and (2) fully enclosed trash rooms and regularly
scheduled trash removal to avoid attracting rodents or other prey that could draw feral cats or
other predators. These measures are proven strategies that many jurisdictions use to minimize
pet predation near sensitive areas. It is also worth noting that this infill project is surrounded by
existing residential developments in the vicinity where outdoor pets are likely already present.
Additionally, there is no evidence that the incremental increase of domestic cats, estimated by the
commenter as approximately 50 cats. This estimated increase in domestic cats at the project site
is not supported by evidence and is therefore speculative (CEQA Guidelines Sections 15064[d][3]
and 15145). Nevertheless, the City HMP Adjacency Standards explicitly require that projects
adjacent to preserves implement measures to control pets/predators. Predation by domestic cats
on birds and other wildlife is a recognized issue primarily associated with single-family residential
development, where cats can freely exit homes and roam yards and adjacent open space. In
contrast, a multi-level apartment building is inherently not conducive to free-roaming cats, as pets
cannot independently open doors or access elevators to enter or exit units. As a result, cats
residing in multi-family developments are predominantly, if not entirely, indoor pets, substantially
reducing the likelihood of access to adjacent habitat.
Moreover, the HMP Adjacency Standards explicitly require that projects adjacent to preserves
implement measures to manage pets and potential predators of developments adjacent to
preserve area. Consistent with these requirements, the project would include provisions pursuant
to the City’s HMP, Objective Design Standards, and Landscape Manual to further minimize any
already low potential for pets entering the adjacent habitat. Specifically, the project would provide
educational materials (e.g., brochures or handbook provisions) to all new residents informing
them of the nearby sensitive habitat and requiring cats be kept indoors, with outdoor access
permitted only if leashed and under direct supervision. Additionally, the project’s landscape plan
would avoid planting features that might inadvertently attract domestic animals to the habitat edge
(e.g., no litter boxes near open space, no features that encourage house pets to roam near the
preserve boundary). It is also noted that the habitat patch is relatively small and bordered on two
sides by existing development or roads. There is not currently nor would the project result in an
accessible path from the proposed apartment complex to the 0.33-acre Diegan coastal sage scrub
patch located in the northwest corner of the site. While the City can manage pet-related risks
through project design and adherence to City requirements, the project’s incremental contribution
to domestic cat presence near the preserve would be negligible. Therefore, future domestic cats
associated with the project would not cause a significant decline in local wildlife populations.
One coastal California gnatcatcher was observed in 2025 in the 0.33-acre Diegan coastal sage
scrub patch on-site, which would be avoided by the project. The consulting biologist concluded
that the individual was transient, most likely residing in the more abundant and established habitat
opposite Salk Avenue and using the patch for foraging. Coastal California gnatcatchers primarily
occupy coastal sage scrub characterized by dense, low-growing shrub cover, where nests are
Comment Letters and Responses to Comments
Salk Avenue Apartments Project Page 2-88
typically placed several feet above ground within intact vegetation, limiting exposure to urban
predators. Predation pressure documented for the species is primarily associated with avian
predators and habitat fragmentation, and domestic cats are not identified by USFWS as a
common or significant source of gnatcatcher mortality.4 In summary, with implementation of
required pet management practices and design features, indirect impacts from potential house
cat predation would be minimized and would remain less than significant. Refer also to
Responses to Comments 1-10 and 2-19.
Response to Comment 2-6
The City acknowledges increased attention to bird-window collisions and continues to address
potential risks through implementation of applicable state and local regulations. The IS/MND did
not specifically analyze bird-window collisions; however, CEQA does not require evaluation or
mitigation of speculative impacts absent substantial evidence that a project would have a
significant effect on biological resources. The project site is located in a developed, urbanized
setting and is not adjacent to large water bodies or expansive natural habitat typically associated
with elevated collision risk. Ms. Smallwood’s speculative collision fatality estimates based on
window area and published collision rates, such projections rely on generalized data from varied
building types and locations rather than site-specific conditions for this mid-rise infill project. The
collision fatality estimates are not supported by substantial evidence and are therefore speculative
for evaluation (CEQA Guidelines Sections 15064[d][3] and 15145). The City enforces existing
state and local regulations that protect migratory and nesting birds during construction and applies
building and lighting standards that are intended, in part, to reduce potential hazards to wildlife
over time. Regarding the commenter’s suggested mitigation measures (i.e., bird-safe glass
treatments, window films, exterior markers), mitigation is not necessary as no potential significant
impacts have been identified. Moreover, such measures would only be appropriate where
substantial evidence demonstrates elevated collision risk. Absent such evidence specific to this
project site, imposition of these measures is not required under CEQA. The proposed apartment
complex would not contain any glass fa ades (other than windows) or glass walkways, which are
cited in Smallwood’s analysis. Rather, the project would include Spanish architecture with stucco
exterior. Based on the project’s setting and compliance with applicable regulations, the project
would not have a significant impact on migratory or resident bird species related to building design
or operation, and no additional analysis or mitigation is required pursuant to CEQA. Refer also to
Response to Comment 2-20.
Response to Comment 2-7
The project would not create a significant new source of wildlife roadkill, and thus, potential traffic-
related wildlife mortality impacts are considered less than significant. The commenter’s assertion
that 1,800 to 4,600 additional animal fatalities per year would occur due to project traffic is
unsupported by site-specific evidence and is therefore speculative (CEQA Guidelines Sections
15064[d][3] and 15145). Such figures are derived from studies including rural highways (Vasco
Road in Contra Costa County) as well as the commenter’s urban/suburban study in Davis,
California; however, neither study reflects conditions comparable to the project’s infill location
along already-developed arterial roads in Carlsbad. The proposed project would add traffic
primarily to busy urban streets (e.g., College Boulevard, El Camino Real) where wildlife presence
4 US Fish and Wildlife Service (USFWS). Coastal California Gnatcatcher Species Profile. https://www.fws.gov/story/coastal-
california-gnatcatcher.
Comment Letters and Responses to Comments
Salk Avenue Apartments Project Page 2-89
is relatively low compared to the rural and semi-rural study areas cited by the commenter. Large
mammals and sensitive species are rarely found on these roadways and local data does not
indicate unusual roadkill hotspots that would be exacerbated by the project. The IS/MND did not
identify such conditions as resulting in a significant impact because any incremental increase in
collisions with common wildlife (such as small rodents or rabbits) would be unlikely to cause a
substantial population decline or threaten any sensitive species. Implementation of standard
operational practices along with the project’s infill nature (which inherently directs traffic onto
developed roads) and minimal direct interaction with undeveloped habitat, would ensure that the
effect of project traffic on wildlife is less than significant. No mitigation is required under CEQA as
the impact does not meet significance criteria (CEQA Guidelines Section 15126.4[a][3]). Refer
also to Response to Comment 2-21.
Response to Comment 2-8
The IS/MND’s analysis of cumulative biological impacts is consistent with the CEQA Guidelines
Section 15063(b) and fully considers the project’s contribution to regional habitat loss and species
decline in Carlsbad. The adopted HMP serves as a comprehensive mitigation program for
cumulative biological effects by establishing a regionwide preserve system and requiring project-
specific habitat mitigation fees or conservation measures for development in non-preserve areas.
The project, located on a site designated for development under the HMP (and not within a
hardline preserve), would comply with all applicable HMP requirements. This includes preserving
the on-site Diegan coastal sage scrub habitat patch, thereby addressing the project’s part in the
regional conservation strategy. In any event, the IS/MND did not identify a cumulatively
considerable impact to specific species or resources. In the broader view, previous disturbance
and grading (in 2007) on the project site have reduced much of the site’s habitat value (and
associated species), and the current project would implement mitigation to address potentially
significant impacts. Considering these factors, the City finds that the project’s incremental effects
on biological resources, when viewed in combination with past and future development in
Carlsbad, would not be cumulatively considerable. The conclusion of less than significant
cumulative impacts is supported by project consistency with the HMP and lack of evidence of a
cumulatively significant decline in biological resources attributable to the project. Refer also to
Response to Comment 2-22.
Response to Comment 2-9
As stated in the IS/MND, the project could result in potentially significant impacts to coastal
California gnatcatcher and Crotch’s bumble bee. MM BIO-1 and MM BIO-2 would reduce potential
impacts to these species to less than significant levels.
MM BIO-1 establishes clear performance standards to avoid and minimize indirect impacts to
coastal California gnatcatchers, including protection of active nests and limitation of
construction-related disturbance. The mitigation measure requires installation of a no-disturbance
buffer around any active coastal California gnatcatcher nest identified by a qualified biologist and
implementation of construction controls to ensure disturbance levels remain below thresholds that
could adversely affect nesting behavior. Consistent with USFWS guidance, these performance
standards are intended to meet or exceed commonly recommended buffers (e.g., approximately
500 feet) and construction noise limits during the breeding season, unless a qualified biologist
determines that site-specific conditions support an alternative protective distance or additional
measures. The City acknowledges that USFWS guidance commonly recommends a minimum
Comment Letters and Responses to Comments
Salk Avenue Apartments Project Page 2-90
500-foot buffer around active gnatcatcher nests and includes construction noise thresholds
intended to limit disturbance during the breeding season. USFWS guidance also allows these
buffers and noise controls to be refined based on site-specific conditions, nest location,
topography, intervening screening, and the nature of construction activities. In no circumstances
shall a buffer of less than 100 feet be used even with noise attenuation measures. Any reduction
in the 500-foot no-disturbance buffer must be supported by site-specific analysis by the qualified
biologist and approved by the City in consultation with USFWS. As a result, MM BIO-1 ensures
that protective measures consistent with USFWS recovery objectives will be implemented, and
the absence of a pre-approval protocol survey will not result in any unmitigated significant impact.
Because the coastal California gnatcatcher is a covered species by the City HMP, the HMP
holistically addresses species concerns on a broader ecosystem scale. By establishing a citywide
preserve system with core areas interconnected with wildlife movement corridors, the City is
protecting the gnatcatcher at buildout and in perpetuity, while allowing development in appropriate
places.
For Crotch’s bumble bee, MM BIO-2 ensures that focused surveys will occur at the appropriate
time (during the flowering/active season) before any ground disturbance, when the species is
most active and detection is most likely. Subsequent to release of the IS/MND for public review,
a site-specific three-survey protocol design was approved by CDFW. The three Crotch’s bumble
bee surveys were conducted in April and May 2026. Crotch’s bumble bee was not detected in any
of the three surveys and the negative findings were reported to CDFW.
Response to Comment 2-10
Refer to Responses to Comments 2-2 through 2-9. The comment summarizes SAFER’s position
that an EIR is required, but it does not introduce new factual issues beyond those addressed in
Comments 2-2 through 2-9. The City has provided detailed responses above, demonstrating that
the IS/MND adequately evaluated and mitigated the project’s impacts on biological resources. As
such, the record does not contain substantial evidence of a potentially significant effect that
remains unmitigated and the IS/MND satisfies CEQA requirements for the project. Therefore,
preparation of an EIR is not required.
Response to Comment 2-11
The comment raises the issue of whether the IS/MND’s focus on special-status species
overlooked broader impacts to the general wildlife community. Pursuant to CEQA, analysis must
be commensurate with the potential for significant impacts. In practice, as reflected in Appendix
G of the CEQA Guidelines, CEQA prioritizes special-status species and sensitive habitats as
proxies for broader ecological health. The IS/MND’s biological analysis evaluated the project site’s
overall habitat value and common wildlife use. It identified the site as mostly disturbed grassland
with a small area of Diegan coastal sage scrub, supporting a typical assemblage of urban-edge
wildlife (various birds, small mammals, reptiles). The project’s expected effects on this common
wildlife assemblage – primarily through habitat removal – were determined to be minor because
the site is not unique or critical for those species, and similar habitat is widespread nearby. The
project does not propose any action that would eliminate an entire species or cause wildlife
populations to fall below self-perpetuating levels; thus, the broad CEQA mandate to protect all
wildlife is not violated. In summary, the City has considered the wildlife community and finds that
the project would not result in a significant adverse change to local fauna or ecological
communities. The analysis appropriately emphasizes special-status species and sensitive
Comment Letters and Responses to Comments
Salk Avenue Apartments Project Page 2-91
communities as required by CEQA, and no further generalized wildlife impact analysis is
necessary.
Response to Comment 2-12
The City acknowledges that Ms. Smallwood’s March 2026 site visit identified more total species
than the January 2026 survey reported; however, this does not indicate a deficiency in the IS/MND
analysis. Many factors influence wildlife detectability (season, time of day, survey duration, etc.),
and it is expected that an early spring survey would record more migratory and breeding bird
activity than a mid-winter survey. However, the additional species noted by Ms. Smallwood were
predominantly common birds and one or two raptor species, all of which are typical for the area
and none of which represent previously unknown sensitive species. Ms. Smallwood extrapolated
from the March survey data to predict that extended surveys would detect 166 vertebrate wildlife
species (including 31 special-status species); however, such statistical modeling does not
constitute substantial evidence and is therefore speculative (CEQA Guidelines Sections
15064[d][3] and 15145). In fact, the modeling relies on extrapolation from brief survey periods and
assumes detection patterns from distant study sites (Altamont Pass) are transferable to this
urban-edge infill parcel. Such assumptions are unwarranted and not based on fact.
Regarding the commenter’s assertion that breeding-season detection surveys for burrowing owl
were not conducted as recommended by CDFW (2012), the project site lacks suitable burrowing
owl habitat (e.g., open grassland with ground squirrel burrows or similar structures); therefore,
protocol-level burrowing owl surveys were not warranted.
Further, the IS/MND conclusions would not change even when considering those additional
observations, because the significance of a biological impact under CEQA depends on the nature
of the impact, not simply the presence of common species. All of the species observed by Ms.
Smallwood are generally well-adapted to urban environments or would continue to be supported
in the region after project implementation (e.g., in yards, parks, and nearby open space).
Preservation of the on-site Diegan coastal sage scrub habitat and implementation of mitigation
(e.g., timing restrictions and buffers for nesting birds) as proposed with the project would further
ensure that loss of the site’s wildlife usage would not cause significant ecological harm. While the
site provides temporary habitat for a variety of wildlife, the overall environmental setting was
accurately captured in the IS/MND and demonstrates that the project is unlikely to significantly
impact local wildlife populations. Refer also to Responses to Comments 2-3 through 2-7.
Response to Comment 2-13
CEQA does not require analysis of impacts that are speculative or unlikely to occur (CEQA
Guidelines Sections 15064[d][3] and 15145). The preparers of the IS/MND followed standard
practice by using the CNDDB as a primary tool to identify special-status species previously
documented in the vicinity of the site. Contrary to the commenter’s assertion that the City’s
biologist “relied on only one database,” the biological resources analysis also consulted the
California Native Plant Society inventory, USFWS Information for Planning and Consultation
(IPaC), and other resources for federally protected species and critical habitat, ensuring a broad
initial list of species for consideration. It is true that CNDDB is a “positive occurrence” database;
however, it remains the most authoritative source for known locations of sensitive species in
California, and it was appropriately used to flag species for analysis. The IS/MND did not assume
that absence of a CNDDB record equates to absence of a species; rather, absence of records
plus lack of suitable habitat on-site led to conclusions of “not expected.” This is a scientifically
Comment Letters and Responses to Comments
Salk Avenue Apartments Project Page 2-92
valid approach, as the potential for a species to occur is inherently tied to whether the environment
can support it. The commenter’s claim that 143 special-status species were “known to occur near”
the site is an over-inclusive list that effectively combines all species reported from a broad region
(up to 30 miles away, per Dr. Smallwood’s Exhibit A) and is therefore speculative (CEQA
Guidelines Sections 15064[d][3] and 15145). The City’s biologists reasonably narrowed the list to
46 special-status species for detailed evaluation, focusing on those with ranges, habitat
requirements, and occurrence records suggesting a plausible presence on or immediately
adjacent to this infill site. For example, wetland- and aquatic-dependent species, as well as
species requiring large habitats, were screened out because the project site contains no wetlands,
streams, or extensive natural communities to support them. This is consistent with CEQA, which
does not require analysis of every species, but rather allows for a more focused consideration of
those species having a reasonable potential to be impacted. This direction supports focusing
species-level analysis only on those with a reasonable potential for impact.
In summary, the desktop review conducted by the City’s biologists provided a foundation for the
field survey and impact analysis, emphasizing those species having the potential to be present
and did not “misuse” the CNDDB. Instead, it combined CNDDB data with habitat assessment and
professional judgment to focus the analysis on relevant species. The result was that the IS/MND
closely examined all biological resources that may be significantly affected by the proposed
development and no substantial evidence has been presented that additional undetected special-
status species are present on the site. Therefore, the City finds the environmental setting
description and species occurrence analysis to be adequate.
Response to Comment 2-14
The comment questions whether the IS/MND mischaracterized the site’s wildlife community due
to limited survey effort and an “inappropriately small pool” of species considered. While no survey
can document every species on a site, the purpose of the CEQA baseline is to capture the
presence of resources in sufficient detail to inform impact analysis. The IS/MND identified the key
habitats on-site, the common wildlife using those habitats, and the special-status species with
potential to occur. Additional context, such as regional species lists or statistical detection
probability analyses, can be useful for academic study; however, CEQA does not require
exhaustive surveys if the anticipated impacts can be understood and mitigated with available
information. The “true wildlife community” of the site is not expected to include rare or unusual
species beyond those already accounted for. Even without documenting every single species, the
IS/MND’s conservative approach (e.g., assuming coastal California gnatcatcher present based
on one observation, assuming Crotch’s bumble bee could be present despite none observed)
ensured that if a potentially sensitive wildlife resource existed, it was considered. The conclusion
that impacts would be less than significant (with mitigation for sensitive species) remains valid.
Preparing an EIR or conducting additional surveys would not change the outcome; the exercise
would simply confirm that the site is used primarily by common species and potentially a limited
number of special-status species that the IS/MND has already addressed. Pursuant to CEQA, the
adequacy of the environmental setting is judged by whether it provides decision-makers with
sufficient information to assess potential impacts. Thus, the City finds no evidence of a deficiency
in the baseline characterization provided in the IS/MND that would warrant a revised impact
prediction or additional mitigation beyond that already proposed.
Comment Letters and Responses to Comments
Salk Avenue Apartments Project Page 2-93
Response to Comment 2-15
The commenter’s Table 2 (Exhibit A) lists 143 special-status wildlife species and implies that the
IS/MND should have analyzed each one’s potential occurrence. The City maintains that such an
expansive analysis is unnecessary and would not yield meaningful additional protection to
biological resources. The analysis in the IS/MND is focused on the subset of species with non-
negligible likelihood of occurrence, considering such factors as habitat presence/absence and
known species distributions. Many species in the commenter’s table require habitat types not
present on the project site (e.g., vernal pools for fairy shrimp, open water for waterfowl, large
undisturbed tracts for certain mammals) or are migratory birds unlikely to rely on this small,
disturbed parcel for any significant portion of their life cycle. Including numerous “in-region”
species some documented miles away would not change the impact analysis, as the project
would not affect those species in the absence of suitable habitat or site usage. CEQA does not
require an agency to analyze every species; rather, it requires agencies to use their best
judgment, based on substantial evidence, to evaluate resources that could be substantially
impacted by a project. The project-specific Biological Resources Technical Report’s narrowed list
of 46 species was developed by considering special-status species that may conceivably use the
subject property. This methodology is consistent with the CEQA Guidelines and longstanding
practice in biological impact assessments. Therefore, the City finds that the list provided by the
commenter does not represent the actual “wildlife community” of the project site, and no additional
significant impacts would be identified by analyzing all such species. The IS/MND’s conclusions
remain accurate based on the evidence gathered for the species that are considered relevant in
this context.
Response to Comment 2-16
The analysis provided in the IS/MND is not considered to be speculative; it is based on scientific
data, including literature review and a habitat assessment/field survey conducted by qualified
biologists (refer to Response to Comment 2-13). CEQA requires a “good faith effort at full
disclosure” using the best available information, rather than absolute scientific certainty. In
preparing the IS/MND and Biological Resources Technical Report, the City’s biologists drew upon
professional experience, established scientific literature, and resource agency guidance to
evaluate the project’s likely effects. For example, the assessment of Crotch’s bumble bee followed
CDFW guidance for evaluating projects with potential bumble bee habitat. Impact conclusions in
the IS/MND are supported by either empirical observations (e.g., the site survey and reference to
historical surveys) or by accepted ecological principles (e.g., understanding that small, isolated
habitat patches have limited carrying capacity for wildlife). The commenter advocates for
extensive comparative data and post-project monitoring to validate predictions, efforts that go far
beyond what CEQA requires for an individual project. Rather, a lead agency is required to consider
available data and make reasonable assumptions in determining whether a significant impact may
occur. In conforming with this approach, the IS/MND conservatively assumes the presence of
sensitive species on-site and identifies appropriate mitigation based on available data, without
resorting to speculation. The IS/MND’s analyses and mitigation measures were formulated using
expertise and recognized standards and represents a scientifically sound basis pursuant to CEQA
requirements. For these reasons, the impact assessment provided in the IS/MND is considered
to be adequate and non-speculative.
Comment Letters and Responses to Comments
Salk Avenue Apartments Project Page 2-94
Response to Comment 2-17
As addressed in Response to Comment 2-3, the on-site habitat (aside from the preserved Diegan
coastal sage scrub patch) is of relatively low ecological value and its proposed removal would not
cause a significant decline in regional bird populations. The comments provided assume that all
61 hypothetical nest sites and 278 birds produced annually on the property would be permanently
lost. However, such assumptions do not constitute substantial evidence and are therefore
speculative (CEQA Guidelines Sections 15064[d][3] and 15145). Further, this analysis does not
account for the fact that birds and other wildlife are mobile and would relocate to adjacent habitats
(including the preserved on-site patch and nearby open spaces) as the site is developed.
Moreover, the Diegan coastal sage scrub patch would remain intact, meaning nesting capacity
for species such as wrentits and California towhees would persist on-site. The City’s
determinations are guided by Appendix G of the CEQA Guidelines, which does not treat the loss
of each individual bird or nest as a significant impact if it does not threaten a species’ population
viability or otherwise cause a substantial adverse change in the environment. Furthermore,
implementation of MM BIO-1 would require the project to avoid direct destruction of any active
nests (those with eggs or chicks) during construction, thereby complying with the Migratory Bird
Treaty Act and the California Fish and Game Code and preventing the direct take of birds. The
IS/MND therefore appropriately determined that impacts from habitat loss (and associated
reduction in nesting/reproductive output) would be less than significant with mitigation measures
incorporated. A more expansive interpretation of significance (treating any reduction in wildlife
usage as “significant”) would be inconsistent with CEQA requirements to identify a substantial
adverse effect and would effectively make any development on disturbed land appear significant,
contrary to the intent of the CEQA Guidelines.
Response to Comment 2-18
As discussed in Response to Comment 2-4, the project would not significantly impact regional
wildlife movement. On-site vegetation and wildlife observations provided by the commenter do
not equate to a crucial movement corridor. Occasional foraging and movement on-site by wildlife
(e.g., birds collecting nest material or moving through the Diegan coastal sage scrub patch) would
not be blocked or substantially altered because the project design would leave the key habitat
area undeveloped and would implement measures to limit disturbance in that area. The site does
not have “stopover” value for migratory birds or other characteristics that would make it uniquely
important. Migratory songbirds and other species can and do use a variety of green spaces
(including developed areas) during transit. The limited size of the parcel means its role as a
stopover is opportunistic, not critical. Additionally, the project would include a landscaping plan
with native trees and shrubs, which can provide some replacement for the low-quality foraging
habitat that would be removed with development of the site’s ruderal portions. The IS/MND’s
conclusions regarding wildlife movement were based on the absence of any large-scale corridor
and the urban context of the site, which the commenter does not refute. Further, CEQA does not
require a project to maintain every minor usage of a site by wildlife. Rather, it asks whether a
project would substantially impede wildlife movement. Wildlife movement on the project site is
already constrained by existing development, and the project’s footprint does not extend into any
larger habitat block. The City finds that the project would not create a significant barrier or cause
wildlife movement to be substantially more constrained than under existing conditions.
Consequently, the impact remains less than significant, as originally addressed in the IS/MND.
Comment Letters and Responses to Comments
Salk Avenue Apartments Project Page 2-95
Response to Comment 2-19
The commenter’s assertion that the project would result in 6,344 wildlife kills per year by 52 free-
roaming cats is not supported by substantial evidence and is therefore speculative (CEQA
Guidelines Sections 15064[d][3] and 15145). Predation by domestic cats on birds and other
wildlife is a recognized issue primarily associated with single-family residential development,
where cats can freely exit homes and roam yards and adjacent open space. In contrast, a multi-
level apartment building is inherently not conducive to free-roaming cats, as pets cannot
independently open doors or access elevators to enter or exit units. As a result, cats residing in
multi-family developments are predominantly, if not entirely, indoor pets, substantially reducing
the likelihood of access to adjacent habitat.
Further, the assumed number of domestic cats associated with the project likely overestimates
for the project site and context, as they rely on national data that include areas with high feral cat
populations and sensitive ecosystems. Nonetheless, the City acknowledges that any avoidable
predation on wildlife is undesirable. Many of the potentially affected species (rodents, small birds)
are abundant in the region, and the project’s design and adherence to requirements set forth in
the City’s HMP, Objective Design Standards, and Landscape Manual would help ensure that
increases in predation are minimized. The City therefore maintains that the project’s impact from
domestic animals would not result in a significant impact. This issue does not involve non-
compliance with any specific regulatory threshold as neither CEQA nor local ordinances consider
incremental pet predation a “significant impact” unless it affects a sensitive species or violates a
policy, which is not the case being considered in this scenario.
Response to Comment 2-20
The City has considered the issue of potential bird collisions with windows that would be installed
on-site with the proposed residential development (see Response to Comment 2-6). Importantly,
it is not standard practice under CEQA to quantify expected bird fatalities for every project,
especially when a project is not located in a known migratory bird concentration area, nor is such
analysis required by law. The project’s location and scale do not suggest an unusually high
collision risk compared to typical urban development; rather, the project proposes a mid-rise
structure in a developed setting, similar to other buildings in Carlsbad that have not been
associated with noteworthy bird mortality events. Ms. Smallwood substantially overestimates the
amount of exterior window area associated with the project, and her statement that bird-window
collision fatalities are higher than nationwide estimates is not supported by evidence and is
therefore speculative (CEQA Guidelines Sections 15064[d][3] and 15145). The IS/MND’s
conclusion that no significant operational impacts to avian species would occur remains valid.
Response to Comment 2-21
As addressed in Response to Comment 2-7, the project’s traffic-related wildlife impacts are
expected to be less than significant. The commenter cites studies of roadkill in various settings
(rural highways, semi-urban roads) and uses an inferred rate per vehicle-miles-traveled to predict
thousands of annual wildlife fatalities from project traffic. This information is not supported by
evidence and is therefore speculative (CEQA Guidelines Sections 15064[d][3] and 15145). The
project is estimated to generate approximately 2,382 average daily trips (ADTs) contributing
vehicle trips to major roadways that already experience tens of thousands of ADTs under existing
conditions. Any wildlife (mostly small mammals, reptiles, and birds typical of urban edges) on area
roadways are already subject to vehicle hazards. Dr. Smallwood overestimates vehicle miles
Comment Letters and Responses to Comments
Salk Avenue Apartments Project Page 2-96
traveled for the project by more than 72 percent compared to City’s analysis. The incremental
increase in traffic from the proposed project would be a fraction of total volumes and would not
create a new significant “death toll” for local wildlife. Additionally, evidence that such incremental
road mortality would threaten any local wildlife populations or involve special-status species is not
presented. The City’s experience with similar infill projects in developed areas has not shown
traffic-wildlife collisions to rise to the level of CEQA significance. CEQA requires mitigation for
significant impacts; given the lack of substantial evidence linking project traffic to a significant
wildlife impact, additional specific mitigation is not merited (CEQA Guidelines Section
15126.4[a][3]). The project’s potential effect on wildlife from increased traffic is expected to be
negligible in the context of existing conditions.
Response to Comment 2-22
The IS/MND’s discussion of cumulative biological impacts (see also Response to Comment 2-8
above) is in line with the CEQA Guidelines Section 15063(b), which focus on whether a project’s
incremental contribution is cumulatively considerable. The City’s reasoning, in combination with
the findings of its biologists, is that the project’s contribution to area-wide habitat loss and wildlife
impacts are addressed through existing frameworks. Specifically, the HMP and related programs
have already accounted for the cumulative loss of habitats, including on the project site, and have
set aside conservation areas to balance growth. The project would be consistent with the HMP
by avoiding direct impacts to sensitive on-site habitat (thus not diminishing the preserved open
space network) and implementing HMP standards to protect adjacent natural lands. In addition,
no aspect of the project would produce a unique or additive effect on biological resources in
combination with other projects. Project-related construction noise would be temporary and
localized; any incremental pet or lighting effects would be managed on-site; and the project would
not substantially affect regional wildlife corridors or water resources. The commenter references
a generalized study pertaining to mitigation effectiveness. As such, this claim is not supported by
substantial evidence and is therefore speculative (CEQA Guidelines Sections 15064[d][3] and
15145). The City can only evaluate the specific context and mitigation for the proposed project.
Based on the evidence, the project would not result in a considerable contribution to cumulative
biological resource issues such as habitat fragmentation or species decline. Other future
development proposed in the project vicinity would also be required to comply with applicable
HMP and CEQA regulations to ensure that overall cumulative effects remain mitigated to the
degree feasible. The IS/MND conclusion that the proposed project would not contribute to a
significant cumulative impact on biological resources remains valid.
Response to Comment 2-23
MM BIO-1 was originally formulated to be flexible, recognizing that appropriate buffer distances
can depend on factors such as avian behavior, location of the nest, existing ambient noise, and
the nature of construction activity.
To directly address the concern raised, the City has updated MM BIO-1 (Pre-Construction Nesting
Bird Surveys, Avoidance, and Notification) to require that, if a gnatcatcher nest is found during
pre-construction surveys, a minimum 500-foot wide no-disturbance buffer be established around
the nest and maintained until a qualified biologist confirms that the young have fledged, the nest
is no longer active, or that construction noise levels can be maintained below 60 dBA Leq at the
nest site with a smaller buffer.
Comment Letters and Responses to Comments
Salk Avenue Apartments Project Page 2-97
A “qualified biologist” is defined as a professional biologist with demonstrated experience
conducting nesting bird surveys in southern California coastal habitats and familiarity with the
identification, behavior, and nesting ecology of avian species known to occur in the region,
including federally listed species such as the coastal California gnatcatcher. By incorporating
these specifics a numeric distance, noise criteria, and biologist qualifications MM BIO-1 would
have clear performance standards. Specifically, MM BIO-1 from the public review IS/MND stated:
MM BIO-1 Pre-Construction Bird Surveys, Avoidance, and Notification.If construction
activities are initiated during the bird nesting season (February 1–August 31)
involving removal of vegetation or other nesting bird habitat, including abandoned
structures and other man-made features, a pre-construction nesting bird survey
shall be conducted no more than 14 days prior to initiation of ground disturbance
and vegetation removal activities. The nesting bird pre-construction survey shall
be conducted on foot and shall include a 300-foot survey buffer around the
construction site. The survey shall be conducted by a biologist familiar with the
identification of avian species known to occur in southern California coastal
communities (i.e., qualified biologist). If active nests are found, an avoidance buffer
shall be determined by a qualified biologist in coordination with the City. The
avoidance buffer width will depend upon the species, the proposed work activity,
and existing disturbances associated with land uses outside of the site, which shall
be demarcated by the biologist with bright orange construction fencing, flagging,
construction lathe, or other means to demarcate the boundary. All construction
personnel shall be notified as to the existence of the buffer zone and to avoid
entering the buffer zone during the nesting season. No ground-disturbing activities
shall occur within the buffer until the biologist has confirmed that breeding/nesting
is completed, and the young have fledged the nest. Encroachment into the buffer
shall occur only at the discretion of the qualified biologist on the basis that the
encroachment will not be detrimental to an active nest. A report summarizing the
pre-construction survey(s) shall be prepared by a qualified biologist and shall be
submitted to the City prior to the commencement of construction activities.
Note To mitigate the potential impact to California gnatcatcher or other nesting
birds, this mitigation measure shall be applied to land use and activities occurring
at the project site. No Pre-Construction Bird Surveys, Avoidance, and Notification
mitigation is required to implement the Study Area-Off-Site Se er Line portion of
the project.
MM BIO-1 has been revised as follows (the bird survey window has been revised to a minimum
of three days prior to ground disturbance, and the second paragraph is newly added text):
MM BIO-1 Pre-Construction Nesting Bird Surveys, Avoidance, and Notification.If
construction activities are initiated during the bird nesting season (February 1–
August 31) involving removal of vegetation or other nesting bird habitat, including
abandoned structures and other man-made features, a pre-construction nesting
bird survey shall be conducted no more than three days prior to initiation of ground
disturbance and vegetation removal activities. The nesting bird pre-construction
survey shall be conducted on foot and shall include a 300-foot survey buffer around
the construction site. The survey shall be conducted by a biologist familiar with the
identification of avian species known to occur in southern California coastal
Comment Letters and Responses to Comments
Salk Avenue Apartments Project Page 2-98
communities (i.e., qualified biologist). If active nests are found, an avoidance buffer
shall be determined by a qualified biologist in coordination with the City. The
avoidance buffer width will depend upon the species, the proposed work activity,
and existing disturbances associated with land uses outside of the site, which shall
be demarcated by the biologist with bright orange construction fencing, flagging,
construction lathe, or other means to demarcate the boundary. All construction
personnel shall be notified as to the existence of the buffer zone and to avoid
entering the buffer zone during the nesting season. No ground-disturbing activities
shall occur within the buffer until the biologist has confirmed that breeding/nesting
is completed, and the young have fledged the nest. Encroachment into the buffer
shall occur only at the discretion of the qualified biologist on the basis that the
encroachment will not be detrimental to an active nest. A report summarizing the
pre-construction survey(s) shall be prepared by a qualified biologist and shall be
submitted to the City prior to the commencement of construction activities.
If an active coastal California gnatcatcher nest is found during pre-construction
surveys, a minimum 500-foot no-disturbance buffer shall be established around
the nest. The buffer shall be clearly marked (e.g., with fencing or flagging) and
maintained until a qualified biologist confirms that the young have fledged, the nest
is no longer active, or that construction noise levels can be maintained below 60
dBA Leq at the nest site with a smaller buffer. In no circumstances shall a buffer of
less than 100 feet be used even with noise attenuation measures. Any reduction
in the 500-foot buffer must be supported by site-specific analysis by the qualified
biologist and approved by the City in consultation with the US Fish and Wildlife
Service.
Note To mitigate the potential impact to California gnatcatcher or other nesting
birds, this mitigation measure shall be applied to land use and activities occurring
at the project site. No Pre-Construction Nesting Bird Surveys, Avoidance, and
Notification mitigation is required to implement the Study Area-Off-Site Se er Line
portion of the project.
It is also noted that such clarification to MM BIO-1 does not represent “significant new information”
as defined in CEQA Guidelines Section 15088.5. The revised MM BIO-1 is more effective than
that presented in the Draft IS/MND. Therefore, recirculation of the IS/MND prior to adoption is not
required (CEQA Guidelines Sections 15073.5[c][1] and 15074.1).
Regarding Crotch’s bumble bee, a site-specific three-survey protocol design was approved by
CDFW subsequent to release of the IS/MND for public review. The three subsequent surveys
were conducted in April and May 2026. Crotch’s bumble bee was not detected in any of the three
surveys and the negative findings were reported to CDFW.
Response to Comment 2-24
The City has reviewed the additional measures suggested by the commenter, including
compensatory habitat protection at a 5:1 ratio, bird-safe glass treatments, native plant
landscaping, and funding for wildlife rehabilitation facilities. The project’s biological resource
impacts have been reduced to a less than significant level through the mitigation measures
identified in the IS/MND (including MM BIO-1 and MM BIO-2), project design (including
avoidance/preservation of the on-site Diegan coastal sage scrub), and applicable HMP
Comment Letters and Responses to Comments
Salk Avenue Apartments Project Page 2-99
requirements and Adjacency Standards. Regarding compensatory habitat protection, the project’s
compliance with HMP requirements addresses the project’s contribution to habitat loss within the
established regional framework. Bird-safe glass treatments are addressed in Response to
Comment 2-6. Native plant landscaping is encouraged through the project’s landscaping plan,
which includes native trees and shrubs; however, mandatory native-only landscaping
requirements are not necessary to reduce impacts to less than significant levels. As the mitigation
identified for the project would adequately reduce project impacts to less than significant,
additional mitigation measures beyond those already required are not warranted under CEQA
(CEQA Guidelines Section 15126.4[a][3]).
6DON$YHQXH$SDUWPHQWV3URMHFW
M m
SCH No. 2026030432
May 2026
/HDG$JHQF\3UHSDUHGE\
&LW\RI&DUOVEDG
&RPPXQLW\'HYHORSPHQW'HSDUWPHQW
)DUDGD\$YHQXH
&DUOVEDG&$
0LFKDHO%DNHU,QWHUQDWLRQDO
$YHQLGD(QFLQDV6XLWH
&DUOVEDG&$
:EϮϬϱϰϴϰ
$WWDFKPHQW%
0LWLJDWLRQ0RQLWRULQJDQG5HSRUWLQJ3URJUDPBBBBBBBBBBBBBBBBBBBBBBBBBB6DON$YHQXH$SDUWPHQWV3URMHFW
WĂŐĞϭ
MITIGATION MONITORING AND REPORTING PROGRAM
INTRODUCTION
7KLV0LWLJDWLRQ0RQLWRULQJDQG5HSRUWLQJ3URJUDP0053KDVEHHQSUHSDUHGLQDFFRUGDQFH
ZLWK WKH UHTXLUHPHQWV RI 3XEOLF 5HVRXUFHV &RGH 35& 6HFWLRQ &DOLIRUQLD
(QYLURQPHQWDO4XDOLW\$FW&(4$*XLGHOLQHV6HFWLRQVWDWHV
,QRUGHUWRHQVXUHWKDWWKHPLWLJDWLRQPHDVXUHVDQGSURMHFWUHYLVLRQVLGHQWLILHGLQWKH(,5
RUQHJDWLYHGHFODUDWLRQDUHLPSOHPHQWHGWKHSXEOLFDJHQF\VKDOODGRSWDSURJUDPIRU
PRQLWRULQJ RU UHSRUWLQJ RQ WKHUHYLVLRQV ZKLFK LW KDV UHTXLUHGLQ WKH SURMHFW DQG WKH
PHDVXUHVLWKDVLPSRVHGWRPLWLJDWHRUDYRLGVLJQLILFDQWHQYLURQPHQWDOHIIHFWV$SXEOLF
DJHQF\PD\GHOHJDWHUHSRUWLQJRUPRQLWRULQJUHVSRQVLELOLWLHVWRDQRWKHUSXEOLFDJHQF\RU
WRDSULYDWHHQWLW\ZKLFKDFFHSWVWKHGHOHJDWLRQKRZHYHUXQWLOPLWLJDWLRQPHDVXUHVKDYH
EHHQFRPSOHWHGWKHOHDGDJHQF\UHPDLQVUHVSRQVLEOHIRUHQVXULQJWKDWLPSOHPHQWDWLRQRI
WKHPLWLJDWLRQPHDVXUHVRFFXUVLQDFFRUGDQFHZLWKWKHSURJUDP
ENFORCEMENT
,QDFFRUGDQFHZLWK&(4$WKHSULPDU\UHVSRQVLELOLW\IRUPDNLQJGHWHUPLQDWLRQVZLWKUHVSHFWWR
SRWHQWLDOHQYLURQPHQWDOHIIHFWVUHVWVZLWKWKHOHDGDJHQF\UDWKHUWKDQZLWKWKHPRQLWRURUSUHSDUHU
$VVXFKWKH&LW\RI&DUOVEDG&LW\LVLGHQWLILHGDVWKHHQIRUFHPHQWDJHQF\IRUWKLV0053
MITIGATION MONITORING AND REPORTING PROGRAM
$VWKHOHDGDJHQF\WKH&LW\ZLOOEHSULPDULO\UHVSRQVLEOHIRUPRQLWRULQJSURMHFWFRPSOLDQFHZLWK
DOOUHTXLUHGPLWLJDWLRQPHDVXUHV7KH0053LGHQWLILHVWKHUHVSRQVLEOHSDUWLHVIRUHQVXULQJHDFK
PHDVXUHLVFRPSOHWHGLWLVH[SHFWHGWKDWRQHRUPRUHSDUWLHVPD\FRRUGLQDWHHIIRUWVWRHQVXUH
FRPSOLDQFH
7KH0053LVSUHVHQWHGLQWDEXODUIRUPRQWKHIROORZLQJSDJHV7KHFRPSRQHQWVRIWKH0053
DUHGHVFULEHGEULHIO\EHORZ
•0LWLJDWLRQ0HDVXUH1XPEHU3URYLGHVWKHPLWLJDWLRQPHDVXUHQXPEHUDVLGHQWLILHGLQ
WKH)RFXVHG,QLWLDO6WXG\0LWLJDWHG1HJDWLYH'HFODUDWLRQ
•0LWLJDWLRQ0HDVXUH,GHQWLILHVWKHGHWDLOVRIHDFKPLWLJDWLRQPHDVXUHUHTXLUHG
•7LPHIUDPHRI0LWLJDWLRQ,GHQWLILHVDWZKLFKVWDJHRIWKHSURMHFWWKHPLWLJDWLRQPHDVXUH
PXVWEHFRPSOHWHG
•5HVSRQVLEOH 3DUW\,GHQWLILHV WKH SDUW\ RU SDUWLHV ZLWK UHVSRQVLELOLW\ IRU PLWLJDWLRQ
PRQLWRULQJHQIRUFHPHQWDQGUHSRUWLQJ
DŝƚŝŐĂƚŝŽŶDŽŶŝƚŽƌŝŶŐĂŶĚZĞƉŽƌƚŝŶŐWƌŽŐƌĂŵͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺ^ĂůŬǀĞŶƵĞƉĂƌƚŵĞŶƚƐWƌŽũĞĐƚ
WĂŐĞϮ
MITIGATION MONITORING AND REPORTING PROGRAM
0LWLJDWLRQ
0HDVXUH
1R0LWLJDWLRQ0HDVXUH
7LPHIUDPH
RI0LWLJDWLRQ
0RQLWRULQJ
(QIRUFHPHQW
DQG5HSRUWLQJ
5HVSRQVLELOLW\
%LRORJLFDO5HVRXUFHV
%,2 3UH&RQVWUXFWLRQ1HVWLQJ%LUG6XUYH\V$YRLGDQFHDQG1RWLILFDWLRQ,IFRQVWUXFWLRQDFWLYLWLHVDUHLQLWLDWHG
GXULQJWKHELUGQHVWLQJVHDVRQ)HEUXDU\±$XJXVWLQYROYLQJUHPRYDORIYHJHWDWLRQRURWKHUQHVWLQJELUG
KDELWDWLQFOXGLQJDEDQGRQHGVWUXFWXUHVDQGRWKHUPDQPDGHIHDWXUHVDSUHFRQVWUXFWLRQQHVWLQJELUGVXUYH\
VKDOOEHFRQGXFWHGQRPRUHWKDQWKUHHGD\VSULRUWRLQLWLDWLRQRIJURXQGGLVWXUEDQFHDQGYHJHWDWLRQUHPRYDO
DFWLYLWLHV7KHQHVWLQJELUGSUHFRQVWUXFWLRQVXUYH\VKDOOEHFRQGXFWHGRQIRRWDQGVKDOOLQFOXGHDIRRW
VXUYH\EXIIHUDURXQGWKHFRQVWUXFWLRQVLWH7KHVXUYH\VKDOOEHFRQGXFWHGE\DELRORJLVWIDPLOLDUZLWKWKH
LGHQWLILFDWLRQRIDYLDQVSHFLHVNQRZQWRRFFXULQVRXWKHUQ&DOLIRUQLDFRDVWDOFRPPXQLWLHVLHTXDOLILHG
ELRORJLVW,IDFWLYHQHVWVDUHIRXQGDQDYRLGDQFHEXIIHUVKDOOEHGHWHUPLQHGE\DTXDOLILHGELRORJLVWLQ
FRRUGLQDWLRQZLWKWKH&LW\7KHDYRLGDQFHEXIIHUZLGWKZLOOGHSHQGXSRQWKHVSHFLHVWKHSURSRVHGZRUNDFWLYLW\
DQGH[LVWLQJGLVWXUEDQFHVDVVRFLDWHGZLWKODQGXVHVRXWVLGHRIWKHVLWHZKLFKVKDOOEHGHPDUFDWHGE\WKH
ELRORJLVWZLWKEULJKWRUDQJHFRQVWUXFWLRQIHQFLQJIODJJLQJFRQVWUXFWLRQODWKHRURWKHUPHDQVWRGHPDUFDWHWKH
ERXQGDU\$OOFRQVWUXFWLRQSHUVRQQHOVKDOOEHQRWLILHGDVWRWKHH[LVWHQFHRIWKHEXIIHU]RQHDQGWRDYRLG
HQWHULQJWKHEXIIHU]RQHGXULQJWKHQHVWLQJVHDVRQ1RJURXQGGLVWXUELQJDFWLYLWLHVVKDOORFFXUZLWKLQWKHEXIIHU
XQWLOWKHELRORJLVWKDVFRQILUPHGWKDWEUHHGLQJQHVWLQJLVFRPSOHWHGDQGWKH\RXQJKDYHIOHGJHGWKHQHVW
(QFURDFKPHQWLQWRWKHEXIIHUVKDOORFFXURQO\DWWKHGLVFUHWLRQRIWKHTXDOLILHGELRORJLVWRQWKHEDVLVWKDWWKH
HQFURDFKPHQWZLOOQRWEHGHWULPHQWDOWRDQDFWLYHQHVW$UHSRUWVXPPDUL]LQJWKHSUHFRQVWUXFWLRQVXUYH\V
VKDOOEHSUHSDUHGE\DTXDOLILHGELRORJLVWDQGVKDOOEHVXEPLWWHGWRWKH&LW\SULRUWRWKHFRPPHQFHPHQWRI
FRQVWUXFWLRQDFWLYLWLHV
,IDQDFWLYHFRDVWDO&DOLIRUQLDJQDWFDWFKHUQHVWLVIRXQGGXULQJSUHFRQVWUXFWLRQVXUYH\VDPLQLPXPIRRWQR
GLVWXUEDQFHEXIIHUVKDOOEHHVWDEOLVKHGDURXQGWKHQHVW7KHEXIIHUVKDOOEHFOHDUO\PDUNHGHJZLWKIHQFLQJRU
IODJJLQJDQGPDLQWDLQHGXQWLODTXDOLILHGELRORJLVWFRQILUPVWKDWWKH\RXQJKDYHIOHGJHGWKHQHVWLVQRORQJHU
DFWLYHRUWKDWFRQVWUXFWLRQQRLVHOHYHOVFDQEHPDLQWDLQHGEHORZG%$/HTDWWKHQHVWVLWHZLWKDVPDOOHU
EXIIHU,QQRFLUFXPVWDQFHVVKDOODEXIIHURIOHVVWKDQIHHWEHXVHGHYHQZLWKQRLVHDWWHQXDWLRQPHDVXUHV
$Q\UHGXFWLRQLQWKHIRRWEXIIHUPXVWEHVXSSRUWHGE\VLWHVSHFLILFDQDO\VLVE\WKHTXDOLILHGELRORJLVWDQG
DSSURYHGE\WKH&LW\LQFRQVXOWDWLRQZLWKWKH86)LVKDQG:LOGOLIH6HUYLFH
1RWH7RPLWLJDWHWKHSRWHQWLDOLPSDFWWR&DOLIRUQLDJQDWFDWFKHURURWKHUQHVWLQJELUGVWKLVPLWLJDWLRQPHDVXUH
VKDOOEHDSSOLHGWRODQGXVHDQGDFWLYLWLHVRFFXUULQJDWWKHSURMHFWVLWH1R3UH&RQVWUXFWLRQ1HVWLQJ%LUG
6XUYH\V$YRLGDQFHDQG1RWLILFDWLRQPLWLJDWLRQLVUHTXLUHGWRLPSOHPHQWWKH6WXG\$UHD2II6LWH6HZHU/LQH
SRUWLRQRIWKHSURMHFW
3ULRUWR
*URXQG
'LVWXUEDQFH
'XULQJ
&RQVWUXFWLRQ
DV$SSOLFDEOH
&LW\RI&DUOVEDG
3XEOLF:RUNV
'HSDUWPHQW
4XDOLILHG
%LRORJLVW
&RQVWUXFWLRQ
&RQWUDFWRU
DŝƚŝŐĂƚŝŽŶDŽŶŝƚŽƌŝŶŐĂŶĚZĞƉŽƌƚŝŶŐWƌŽŐƌĂŵͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺ^ĂůŬǀĞŶƵĞƉĂƌƚŵĞŶƚƐWƌŽũĞĐƚ
WĂŐĞϯ
0LWLJDWLRQ
0HDVXUH
1R0LWLJDWLRQ0HDVXUH
7LPHIUDPH
RI0LWLJDWLRQ
0RQLWRULQJ
(QIRUFHPHQW
DQG5HSRUWLQJ
5HVSRQVLELOLW\
%,2&URWFK¶V%XPEOH%HH$YRLGDQFHDQG&OHDUDQFH6XUYH\
•)RFXVHG6XUYH\7KUHHRQVLWHVXUYH\VIRU&URWFK¶VEXPEOHEHH&%%VKDOOEHFRQGXFWHGSULRUWRLQLWLDWLRQ
RIJURXQGGLVWXUELQJSURMHFWDFWLYLWLHVWRLGHQWLI\LIWKH&%%LVSUHVHQWZLWKLQWKHSURMHFWVLWH7KLVVXUYH\
VKDOOEHFRQGXFWHGVLPXOWDQHRXVO\ZLWKWKHEORRPLQJSHULRGRIWKHVSHFLHV¶UHFRJQL]HGIRRGSODQWVZKHQ
WKH&%%LVPRVWDFWLYH(DFKVXUYH\VKDOOEHVSDFHGDWOHDVWZHHNVEXWQRPRUHWKDQZHHNVDSDUW
FRUUHVSRQGLQJZLWKWKH&RORQ\$FWLYH6HDVRQIRU%RPEXVVSHFLHV$SULO±$XJXVW7KHVXUYH\LQJELRORJLVW
VKDOOEHIDPLOLDUZLWKWKHSULPDU\LGHQWLILFDWLRQFKDUDFWHULVWLFVRIWKH&%%DQGEHSURILFLHQWLQWKH
PHWKRGRORJ\SURGXFHGE\WKH;HUFHV6RFLHW\7KHTXDOLILHGELRORJLVWVKDOOXWLOL]HDWHOHSKRWROHQVRUD
VXIILFLHQWO\ORQJPDFUROHQVWRREWDLQKLJKTXDOLW\SKRWRVRIEXPEOHEHHVVXIILFLHQWIRUVSHFLHVLGHQWLILFDWLRQ
ZLWKRXWKDYLQJWRFDSWXUHDQGSRWHQWLDOO\KDUPWKHEXPEOHEHHV
•$EVHQFHRI6SHFLHV,IQR&%%DUHGHWHFWHGGXULQJWKHIRFXVHGVXUYH\VQRIXUWKHUPHDVXUHVVKDOOEH
QHFHVVDU\
•3UHVHQFHRI6SHFLHV,I&%%DUHGHWHFWHGWKHQVLWHVSHFLILFPHDVXUHVVKDOOEHLPSOHPHQWHGWRDYRLGWDNH
XQOHVVDQ,QFLGHQWDO7DNH3HUPLW,73IRUWKHVSHFLHVLVREWDLQHGIURP&DOLIRUQLD'HSDUWPHQWRI)LVKDQG
:LOGOLIH&'):6XFKDYRLGDQFHPHDVXUHVVKDOOLQFOXGH
o ,IYHJHWDWLRQUHPRYDODFWLYLWLHVDQGLQLWLDOJURXQGGLVWXUELQJDFWLYLWLHVLHFOHDULQJJUXEELQJDQGLQLWLDO
VLWHJUDGLQJRFFXUGXULQJWKH4XHHQDQG*\QH)OLJKW3HULRGDQG&RORQ\$FWLYH3HULRGIRUWKHVHVSHFLHV
)HEUXDU\±2FWREHUDTXDOLILHGELRORJLVWVKDOOFRQGXFWGDLO\ELRORJLFDOPRQLWRULQJ'XULQJPRQLWRULQJWKH
TXDOLILHGELRORJLVWVKDOOLQVSHFWVXLWDEOHKDELWDWIRU&%%DFWLYLW\ZLWKLQWKHGD\¶VZRUNDUHD,IWKHVSHFLHV
LVQRWGHWHFWHGWKHQSURMHFWDFWLYLWLHVFDQSURFHHGZLWKRXWIXUWKHUELRORJLFDOPRQLWRULQJWKDWGD\
o ,IWKH&%%LVGHWHFWHGXVLQJQHFWDUVRXUFHVWKHQDQRGLVWXUEDQFHEXIIHURIDWOHDVWIHHWDURXQGWKH
LQGLYLGXDOVVKDOOEHHVWDEOLVKHGDQGWKHLQGLYLGXDOVVKDOOEHPRQLWRUHGE\DELRORJLFDOPRQLWRUXQWLOWKH
&%%DUHFRQILUPHGWRKDYHOHIWWKHDUHDRQWKHLURZQ
o ,ID&%%QHVWLVGHWHFWHGZKHUHJURXQGGLVWXUEDQFHLVSURSRVHGWRRFFXUWKHQDPLQLPXPIRRWQR
GLVWXUEDQFHEXIIHUZLWKDEXIIHURIXSWRIHHWLIGLVWXUEDQFHLVVXEVWDQWLDODURXQGWKHQHVWVKDOOEH
HVWDEOLVKHG7KLVEXIIHUVKDOOUHPDLQLQSODFHXQWLOWKHQHVWVHQHVFHVZKLFKZRXOGRFFXUDIWHUQRQHVW
DFWLYLW\REVHUYDWLRQVIRUWKUHHVHTXHQWLDOGD\V7KHTXDOLILHGELRORJLVWVKDOOGLVFXVVWKHEXIIHUZLWKWKH
FRQWUDFWRUWRHQVXUHWKDWZRUNDUHDVLQFOXGLQJLQJUHVVDQGHJUHVVURXWHVDYRLGWKH&%%
o ,IWKHSURMHFWFDQQRWDYRLGWKHHVWDEOLVKHGQRGLVWXUEDQFHEXIIHUVLGHQWLILHGDERYHWKHSURMHFWDSSOLFDQW
VKDOOKDOWZRUNZLWKLQWKHEXIIHUDUHDDQGVKDOOFRQVXOWZLWK&'):RQDSSURSULDWHDYRLGDQFHDFWLRQVDQG
REWDLQDQ,QFLGHQWDO7DNH3HUPLWLIQHFHVVDU\
1RWH7RPLWLJDWHWKHSRWHQWLDOLPSDFWWR&URWFK¶V%XPEOH%HH&%%WKLVPLWLJDWLRQPHDVXUHVKDOOEHDSSOLHGWR
ODQGXVHDQGDFWLYLWLHVRFFXUULQJDWWKHSURMHFWVLWH1R&%%$YRLGDQFHDQG&OHDUDQFH6XUYH\PLWLJDWLRQLV
UHTXLUHGWRLPSOHPHQWWKH6WXG\$UHD2II6LWH6HZHU/LQHSRUWLRQRIWKHSURMHFW
3ULRUWR
*URXQG
'LVWXUEDQFH
'XULQJ
&RQVWUXFWLRQ
DV$SSOLFDEOH
&LW\RI&DUOVEDG
3XEOLF:RUNV
'HSDUWPHQW
4XDOLILHG
%LRORJLVW
&RQVWUXFWLRQ
&RQWUDFWRU