The URL can be used to link to this page

Home My WebLink About2620 ACUNA CT; ; CB940957; PermitI BUILDING PERMIT 11/02/95 11:15 Project No: A9401351 Permit No: CB940957 Page 1 of 1 Job Address: 2620 ACUNA CT Permit Type: RESIDENTAL ADD/ALT Parcel No: 215-491-18-00 Lot#: Valuation: Occupancy Group: R3/M1 Description: 165 SF ADDITION Applied: 08/04/94 Apr/Issue: 11/02/95 Development No: Suite: 15,510 Construction Type: VN Reference#: Status: ISSUED Appl/Ownr : ROYCE, ROBERT 619 434-6259 Entered By: MDP CARLSBAD, CA. 92008 2956 ROOSEVELT #3 x** Fees Required *** llected & Credits **x """"""""" Fees : Adjustments : Total Fees: """""""~" .OO 328.00 .00 Ext fee Data Fee description """""""""_ Building Permit Plan Check Strong Motion Fee k BUILDING TOTAL Enter "Y" for Ele Enter "Y" for Tern * ELECTRICAL TOTA Enter 'Y' for Mec Install Furn/Ducts/ * MECHANICAL TOTAL """"""""" 171.00 111.00 2.00 284.00 10.00 Y 10.00 Y 20.00 15.00 Y 9 .OO 24.00 FINAL APPROVAL INSP. DATE CLEARANCE CITY OF CARLSBAD 2075 Las Palms Dr., Carlsbad, CA 92009 (619) 438-1161 , *' CITY OF CARLShD INSPECTION REQUEST PERMIT# CB940957 FOR 03/28/96 DESCRIPTION: 165 SF ADDITION TYPE: RAD JOB ADDRESS: 2620 ACUNA CT APPLICANT: ROYCE, ROBERT CONTRACTOR: PHONE : OWNER: PHONE : INSPECTOR AREA PY PLANCKY CB940957 OCC GRP R3/M1 CONSTR. TYPE VN STE : LOT: PHONE: 619 434-6259 TOTAL TIME: --RELATED PERMITS-- PERMITd TYPE STATUS EXPIRED CB881248 CD LVL DESCRIPTION ACT COMMENTS 19 ST Final Structural 29 PL Final Plumbing 39 EL Final Electrical 49 ME Final Mechanical " " " * - ***** INSPECTION HISTORY ***** DATE 012496 010296 122695 122195 121295 121295 113095 120595 112295 112295 DESCRIPTION Gas/Test/Repairs Interior Lath/Drywall Rough Combo Frame/Steel/Bolting/Welding Shear Panels/HD's Shear Panels/HDts Shear Panels/HD's Roof/Reroof Ftg/Foundation/Piers Roof/Reroof ACT INSP AP PY COMMENTS AP PY AP PY OK TO DRYWALL PA PD co PY AT REAR ADD AP PY PA PD AP PY co PY co PY SEE 11/22 LIST BUlLDlNQ CITY OF CARLSBAD DEPARTMENT NOTiCE DATE I&/, TIME LOCATION do0 r4CJfl4 cr PERMIT NO. qs” 457 2075 LAS PALMAS DRIVE FOR INSPECTION CALL 43&3101. RE-INSPECTldN FEE DUE? YES FOR FURTHER INFORMATION, CONTACT 4”Ufld PHDNE WlLDlRG INSPEClDR WDE ENFORCEMENT OFFICER @ CITY OF CARLSBAD NOTICE BUILDING DEPART-MENT 438-3550 2075 LAS PALMAS DRIVE DATE * TIME LOCATION 07Gm Acud4 d- PERMIT NO. FOR INSPECTION CALLf38-3101. RE-INSPECTION FEE DUE? YES PWNE CODE ENFORCEMENT OFFICER @ EsGil Corporation %?ofessionaf Plbn xeuiew %ginccrs DATE: November 29, 1995 JURISDICTION: Carlsbad PLAN CHECK NO.: 94-957 REV 2 SET I PROJECT ADDRESS: 2620 Acuna Ct. PROJECT NAME: Parker SFD GLB Relocation 0 FIRE 0 PLAN REVIEWER 0 FILE IXI The plans transmitted herewith have been corrected where necessary and substantially comply with the jurisdiction’s building codes. 0 The plans transmitted herewith will substantially comply with the jurisdiction’s ********** codes when minor deficiencies identified below are resolved and checked by building department staff. 0 The plans transmitted herewith have significant deficiencies identified on the enclosed check list and should be corrected and resubmitted for a complete recheck. The check list transmitted herewith is for your information. The plans are being held at Esgil Corporation until corrected plans are submitted for recheck. 0 The applicant’s copy of the check list is enclosed for the jurisdiction to forward to the applicant contact person. 0 The applicant‘s copy of the check list has been sent to: 0 Esgil Corporation staff did not advise the applicant that the plan check has been completed. IXI Esgil Corporation staff did advise the applicant that the plan check has been completed. Person contacted: Chuck Trayer Date contacted: 11/29/95 (by: kc) Telephone #: 729-5567 REMARKS: Notes: 1. The inspector should verify that the relocated beam directly connects to the steel column shown on the framing plans (i.e., the column should have been relocated, too. 2. Plans hand-carried by applicant. By: Kurt Culver Enclosures: Esgil Corporation 0 GA 0 CM 0 GP 0 PC 11/17/95 tmsmtl.dot 9320 Chesapeake Drive, Suite 208 San Diego, California 92123 (619) 560-1468 Fax (619) 560-1576 b ,. Carlsbad 94-957 REV 2 November 29,1995 VALUATION AND PLAN CHECK FEE JURISDICTION: Carlsbad PREPARED BY: Kurt Culver BUILDING ADDRESS: 2620 Acuna Ct. PLAN CHECK NO.: 94-957 REI DATE: November 29, 1995 BUILDING OCCUPANCY: TYPE OF CONSTRUCTION: 112 1 I I UBC Building Permit Fee: $ UBC Plan Check Fee: $ Comments: Review of framing revision: Esgil fee = 1 hr. @ 87.1Whr. = 87.15. Sheet 1 of 1 valuefee.dot 11116119% 11:35 28872652% :. . .I "".. . .. ""_. . CA 94- 957 " . EsGil Corporatlon TrofusionalTh Review Engineers DATE: October 13, 1995 JURISDICTION: Carlsbad PLAN CHECK NO.: 94-957 REV 0 FIRE 0 FILE SET I1 PROJECT ADDRESS: 2620 Acuna Ct. PROJECT NAME: Parker SFD Addition -- Add Exercise Room [XI The plans transmitted herewith have been corrected where necessary and substantially comply with the jurisdiction's building codes. 0 The plans transmitted herewith will substantially comply with the jurisdiction's ********** codes when minor deficiencies identified below are resolved and checked by building department staff. 0 The plans transmitted herewith have significant deficiencies identified on the enclosed check list and should be corrected and resubmitted for a complete recheck. 0 The check list transmitted herewith is for your information. The plans are being held at Esgil Corporation until corrected plans are submitted for recheck. 0 The applicant's copy of the check list is enclosed for the jurisdiction to forward to the applicant contact person. 0 The applicant's copy of the check list has been sent to: Esgil Corporation staff did not advise the applicant that the plan check has been completed. 0 Esgil Corporation staff did advise the applicant that the plan check has been completed. Person contacted: Date contacted: (by: ) Telephone #: 0 REMARKS: By: Kurt Culver Enclosures: City-approved Esgil Corporation plans. 0 GA 0 CM 0 GP 0 PC 1019195 tmsmtl.dot 9320 Chesapeake Drive, Suite 208 + San Diego, California 92123 + (619) 560-1468 + Fax (619) 560-1576 EsGii Corporation TrofcssionalThn Quicw Engineers DATE: September 25,1995 JURISDICTION: Carlsbad PIAN CHECK NO.: 94-957 REV SET I PROJECT ADDRESS: 2620 Acuna Ct. PROJECT NAME: Parker SFD Addition -- Add Exercise Room 0 APPLICANT P 0- JSE",,,, 0 FIRE 0 FILE 0 The plans transmitted herewith have been corrected where necessary and substantially comply with the jurisdiction's *********** codes. 0 The plans transmitted herewith will substantially comply with the jurisdiction's ********** codes when minor deficiencies identified below are resolved and checked by building department staff. 0 The plans transmitted herewith have significant deficiencies identified on the enclosed check list and should be corrected and resubmitted for a complete recheck. IXI The check list transmitted herewith is for your information. The plans are being held at Esgil Corporation until corrected plans are submitted for recheck. 0 The applicant's copy of the check list is enclosed for the jurisdiction to forward to the applicant contact person. The applicant's copy of the check list has been sent to: Robert Royce 2956 Roosevelt St., Suite 3 Carlsbad 92008 Esgil Corporation staff did not advise the applicant that the plan check has been completed. 0 Esgil Corporation staff did advise the applicant that the plan check has been completed. Person contacted: Date contacted: (by: 1 Telephone #: 0 REMARKS: By: Kurt Culver Enclosures: Esgil Corporation 0 GA 0 CM 0 GP 0 PC 911 8/95 tmsmtl.dot 9320 Chesapeake Drive, Suite 208 + San Diego, California 92123 + (619) 560-1468 + Fax (619) 560-1576 Carlsbad 94-957 REV September 25, 1995 GENERAL PLAN CORRECTION LIST PROJECT ADDRESS: 2620 Acuna Ct. DATE PLAN RECEIVED BY DATE REVIEW COMPLETED: ESGIL CORPORATION: 9/18/95 September 25, 1995 REVIEWED BY: Kurt Culver FOREWORD (PLEASE READ): This plan review is limited to the technical requirements contained in the Uniform Building Code, Uniform Plumbing Code, Uniform Mechanical Code, National Electrical Code and state laws regulating energy conservation, noise attenuation and disabled access. This plan review is based on regulations enforced by the Building Department. You may. have other corrections based on laws and ordinances enforced by the Planning Depattment, Engineering Department or other departments. The following items need clarification, modification or change. All items must be satisfied before the plans will be in conformance with the cited codes and regulations. Per Sec. 303 (c), 1991 Uniform Building Code, the approval of the plans does not permit the violation of any state, county or city law. 1. Please make all corrections on the original tracings and submit two new sets of prints to: ESGlL CORPORATION. 2. To facilitate rechecking, please identify, next to each item, the sheet of the plans upon which each correction on this sheet has been made and return this sheet with the revised plans. 3. Please indicate here if any changes have been made to the plans that are not a result of corrections from this list. If there are other changes, please briefly describe them and where they are located on the plans. Have changes been made not resulting from this list? 0 Yes 0 No 4. The plans submitted were too faint to read. 5. Submit revised energy calculations. 6. Show on the plans that the existing garage door header is a 6x16 (and Select Structural). Carlsbad 94-957 REV September 25, 1995 7. The jurisdiction has contracted with Esgil Corporation located at 9320 Chesapeake Drive, Suite 208, San Diego, California 92123; telephone number of 619/560-1468, to perform the plan review for your project. If you have any questions regarding these plan review items, please contact Kurt Culver at Esgil Corporation. Thank you. Carlsbad 94-957 REV September 25, 1995 VALUATION AND PLAN CHECK FEE JURISDICTION: Carlsbad PREPARED BY: Kurt Culver BUILDING ADDRESS: 2620 Acuna Ct. PLAN CHECK NO.: 94-957 REV DATE: September 25, 1995 BUILDING OCCUPANCY: R3 TYPE OF CONSTRUCTION: V-N UBC Building Permit Fee: UBC Plan Check Fee: Comments: $ 171.00 $ 111.15 Sheet 1 of 1 valuefee.dot ESGIL CORPORATION 9320 CHESAPEAKE DR., SUITE 208 SAN DIEGO, CA 92123 (619) 560-1468 DATE: July 6, 1995 JURISDICTION: Carlsbad PLAN CHECK NO.: 94-957 REV PROJECT ADDRESS: 2620 Acuna Ct. PROJECT NAME: Parker SFD Addition and Revision 0 FILE SET I11 The plans transmitted herewith have been corrected where necessary and substantially comply with the jurisdiction's building codes. 0 The plans transmitted herewith will substantially comply with the jurisdiction's building codes when minor deficiencies identified below are resolved and checked by building department staff. 0 The plans transmitted herewith have significant deficiencies identified on the enclosed check list and should be corrected and resubmitted for a complete recheck. 0 The check list transmitted herewith is for your information. The plans are being held at Esgil Corporation until corrected plans are submitted for recheck. 0 The applicant's copy of the check list is enclosed for the jurisdiction to forward to the applicant contact person. 0 The applicant's copy of the check list has been sent to: [XI Esgil Corporation staff did not advise the applicant that the plan check has been completed. 0 Esgil Corporation staff did advise the applicant that the plan check has been completed. Person contacted: Date contacted: (by: 1 Telephone #: 0 REMARKS: By: Kurt Culver Esgil Corporation 0 GA 0 CM 0 PC Enclosures: City-approved plans tmsmtl.dot ESGIL CORPORATION 9320 CHESAPEAKE DR., SUITE 208 SAN DIEGO, CA 92123 (619) 560-1468 DATE: June 29, 1995 JURISDICTION: Carlsbad PLAN CHECK NO.: 94-957 REV SET I1 PROJECT ADDRESS: 2620 Acuna Ct. PROJECT NAME: Parker SFD Addition and Revision 0 The plans transmitted herewith have been corrected where necessary and substantially comply with the jurisdiction's building codes. 0 The plans transmitted herewith will substantially comply with the jurisdiction's building codes when minor deficiencies identified below are resolved and checked by building department staff. 0 The plans transmitted herewith have significant deficiencies identified on the enclosed check list and should be corrected and resubmitted for a complete recheck. The check list transmitted herewith is for your information. The plans are being held at Esgil Corporation until corrected plans are submitted for recheck. The applicant's copy of the check list is enclosed for the jurisdiction to forward to the applicant contact person. The applicant's copy of the check list has been sent to: Robert Royce 2956 Roosevelt Suite 3 Carlsbad 92008 Esgil Corporation staff did not advise the applicant that the plan check has been completed [XI Esgil Corporation staff did advise the applicant that the plan check has been completed. Person contacted: Robert Royce (AdrdtbdG t-hcclde) Date contacted: b/Z?/% (by: M. ) Telephone #: 434-6259 REMARKS: Note to City staff: Additional revisions have been made. A new permit application should be completed, new fees collected and clearances obtained from other departments. By: Kurt Culver Enclosures: Fee Sheet Esgil Corporation 0 GA [7 CM PC 6/22/95 lmsrnll.do1 " Carlsbad 94-957 REV I1 June 29, 1995 RECHECK PLAN CORRECTION LIST PROJECT ADDRESS: 2620 Acuna Ct. SET: I1 DATE PLAN RECEIVED BY DATE RECHECK COMPLETED: ESGIL CORPORATION: 6/22/95 June 29, 1995 FOREWORD (PLEASE READ): This plan review is limited to the technical requirements contained in the Uniform Building Code, Uniform Plumbing Code, Uniform Mechanical Code, National Electrical Code and state laws regulating energy conservation, noise attenuation and disabled access. This plan review is based on regulations enforced by the Building Department. You may have other corrections based on laws and ordinances enforced by the Planning Department, Engineering Department or other departments. The following items need clarification, modification or change. All items must be satisfied before the plans will be in conformance with the cited codes and regulations. Per Sec. 303 (c), 1991 Uniform Building Code, the approval of the plans does not permit the violation of any state, county or city law. A. Please make all corrections on the original tracings and submit two new sets of prints to: ESGIL CORPORATION. B. To facilitate rechecking, please identify, next to each item, the sheet of the plans upon which each correction on this sheet has been made and return this sheet with the revised plans. C. The following items have not been resolved from the previous plan reviews. The original correction number has been given for your reference. Please contact me if you have any questions regarding these items. D. Please indicate here if any changes have been made to the plans that are not a result of corrections from this list. If there are other changes, please briefly describe them and where they are located on the plans. Have changes been made not resulting from this list? UYes UNO Carlsbad 94-957 REV I1 June 29, 1995 3. Additional revisions have been made: A. The spiral stair detail shown on sheet 3 is insufficient. Provide complek (legible) plans, details and calculations. B. The spiral stair plans show anchorage to a landing, yet don’t show the framing for the landing (since that will be unique for each project). The framing plans on sheet 6 of the plans must detail the landing there. C. Provide complete detailing md calculations for the glass rail system. Please review portions of UBC Sec. 5406 (0. 10. The center 6x14 beam in the garage appears to be overstressed. Please provide calculations. 14. The footing size has been erased for the right side of the glu-lam beam. Show the size of the footing (42” sq.) and rebar in it. If you have any questions regarding these items, please contact Kurt Culver of Esgil Corporation at (619) 560-1468. Thank you. Carlsbad 94-957 REV I1 June 29, 1995 VALUATION AND PLAN CHECK FEE JURISDICTION: Carlsbad PLAN CHECK NO.: 94-957 REV PREPARED BY: Kurt Culver DATE: June 29,1995 BUILDING ADDRESS: 2620 Acuna Ct. BUILDING OCCUPANCY: TYPE OF CONSTRUCTION: Air Conditioning Building Permit Fee: $ Plan Check Fee: $ Comments: Additional revisions to plans: Esgil fee = 1 hour @ 87.151hr. = 87.15. City fee = 87.15l0.8 =108.94. Sheet of valuefee.dot .. i ESGIL CORPORATION 9320 CHESAPEAKE DR., SUITE 208 SAN DIEW, CA 92123 (619) 560-1468 DATE: May 10, 1995 JURISDICTION: Carlsbad PLAN CHECK NO.: 94-957 REV SET I PROJECT ADDRESS: 2620 Acuna Ct. PROJECT NAME: Parker SFD Addition and Revision 0 0 €4 0 IXI 0 0 0 PLAN REVIEWER 0 FILE The plans transmitted herewith have been corrected where necessary and substantially comply with the jurisdiction's building codes. The plans transmitted herewith will substantially comply with the jurisdiction's building codes when minor deficiencies identified below are resolved and checked by building department staff. The plans transmitted herewith have significant deficiencies identified on the enclosed check list and should be corrected and resubmitted for a complete recheck. The check list transmitted herewith is for your information. The plans are being held at Esgil Corporation until corrected plans are submitted for recheck. The applicant's copy of the check list is enclosed for the jurisdiction to forward to the applicant contact person. The applicant's copy of the check list has been sent to: Robert Royce 2956 Roosevelt Suite 3 Carlsbad 92008 Esgil Corporation staff did not advise the applicant that the plan check has been completed. Esgil Corporation staff did advise the applicant that the plan check has been completed. Person contacted: Date contacted: (by: ) Telephone #: REMARKS: By: Kurt Culver Enclosures: Esgil Corporation 0 GA 0 CM 0 PC 5/1/95 tmsmtl.dot . Carlsbad 94-957 REV May 10,1995 3 GENERAL PLAN CORRECTION LIST PROJECT ADDRESS: 2620 Acuna Ct. DATE PLAN RECEIVED BY DATE REVIEW COMPLETED: ESGIL CORPORATION: 5/1/95 May 10,1995 FOREWORD (PLEASE READ): This plan review is limited to the technical requirements contained in the Uniform Building Code, Uniform Plumbing Code, Uniform Mechanical Code, National Electrical Code and state laws regulating energy conservation, noise attenuation and disabled access. This plan review is based on regulations enforced by the Building Department. You may have other corrections based on laws and ordinances enforced by the Planning Department, Engineering Department or other departments. The following items need clarification, modification or change. All items must be satisfied before the plans will be in conformance with the cited codes and regulations. Per Sec. 303 (c), 1991 Uniform Building Code, the approval of the plans does not permit the violation of any state, county or city law. 1, Please make all corrections on the original tracings and submit two new sets of prints to: ESGIL CORPORATION. 2. To facilitate rechecking, please identify, next to each item, the sheet of the plans upon which each correction on this sheet has been made and return this sheet with the revised plans. 3. Please indicate here if any changes have been made to the plans that are not a result of corrections from this list. If there are other changes, please briefly describe them and where they are located on the plans. Have changes been made not resulting from this list? 0 Yes 0 No 4. Fill out a new permit application for the new addition, and obtain all necessaty clearance for the addition. 5. Specify the manufacturer md ICBO # for the deck surfacing material. 6. Show tempered glass for the windows next to the doors at the first and second levels of the addition. 7. 8. 9. IO. 11. 12. 13. 14. 15. Carlsbad 94-957 REV May 10,1995 ‘3 Sheet 5 shows that there will be lateral resistance at the addition in the left-to-right direction. Show lateral resistance in the perpendicular direction, too. Along the northwest side, there does not appear to be any shear wall in the existing portion to immediately “drag” into. Detail the connection at the top of the WF column. Per the lateral calculations, the detail must show adequacy to transfer 3000 Ibs. Submit new energy calculations. Provide a calculations to investigate the existing footing below the existing 4x6 column in the garage (for ALL loads involved). On sheet 4, specify the beam size in the middle of the garage. Specify the connection at the left side of that beam. Provide a calculation for the beam that supports the beam from # 11 above. Justify the size of the footing below the 4x8 column at the glu-lam beam. The jurisdiction has contracted with Esgil Corporation located at 9320 Chesapeake Drive, Suite 208, San Diego, California 92123; telephone number of 619/560-1468, to perform the plan review for your project. If you have any questions regarding these plan review items, please contact Kurt Culver at Esgil Corporation. Thank you. Carlsbad 94-957 REV May 10, 1995 VALUATION AND PLAN CHECK FEE JURISDICTION: Carlsbad PLAN CHECK NO.: 94-957 REV 2.l g'm PREPARED BY: Kurt Culver DATE: May 10, 1995 BUILDING ADDRESS: 2620 Acuna Ct. BUILDING OCCUPANCY: R3/M1 TYPE OF CONSTRUCTION: I I I I I I I - Air Conditioning Fire Sprinklers TOTAL VALUE I I I I I Building Permit Fee: $ Plan Check Fee: $ Comments: Framing revisions and 235 sq. ft. addition: Esgil fee = 2% hours @ 87.1Whr. = 217.88. Sheet 1 of 1 valuefee.dot ESGIL CORPORATION 9320 CHESAPEAKE DR., SUITE 208 SAN DIEGO. CA 021 23 (619) 560-1468 DATE : 9-24- 97 JURISDICTION: CA4'5 &ad PLAN CHECK NO: 9y- ? 57 SET: sups PROJECT ADDRESS : 2 2 0 ACLINh' Cr OFILE COPY ODESIGNER PROJECT NAHE: SF& , AUd . The plans transmitted herewith have been corrected where building codes. The Dlans transmitted herewith will substantiallv comDlv 0 necessary and substantially comply with the .jurisdiction's with'the jurisdiction's building codes when mino; deficlen- checked by building department staff. ' cies identified &&cor3 are resolved and 0 identified on the enclosed check list and should be corrected The plans transmitted herewith have significant deficiencies and resubmitted for a complete recheck. The check list transmitted herewith is for your information. plans are submitted for recheck. The applicant's copy of the check list is enclosed for the 0 The plans are being held at Esgil Corp. until corrected 0 jurisdiction to return to the applicant contact person. 0 The applicant's copy of the check list has been sent to: 0 Esgil staff did not advise the applicant contact person that plan check has been completed. a been completed. Person contacted: Esgil staff - did advise applicant that the plan check has Date contacted: 9-29-7Y Telephone # L/3L/- GZ57 a Ah*NflT Ho *e& a REMARKS: /t/0'7d OW fHd 5 C t~/d /AJC) /u 8Uow CLO5LSI 0 Aa &,wc- /3L, 2'' % ALL^^ Rmcl go fi R-30 /dSaLar.ou Aaw L&UI.CL cd/c/u 5 By : ESGIL CORPORATION AoR,w&~ Enclosures: .- ESGIL CORPORATION 9320 CHESAPEAKE DR.. SUITE 208 S.4N DIEGO, Ch 92123 (619) 560.1468 0 identified on tha e?.closed check list and shonld be corifcce(~ The plans transxitted herewith have sipificant deficiencies and resubmitted for a coxplete recheck. The check list transsitted herewith is for your information. The plans are being held 2t 'isqil Corp. until corrected plans are sujmitted for recheck. The a2plican.t'~ co~y of the check list is enclosed for t5e .- @ 0 jurisdiction to return to the applicant contact person. The applicant's copy of the check list has been sent to: /76&EORI J-flOYC6 29 56 flooSou6~7 ClqrPL J *A* e3 A e2 OOR 0 Esqil staff did not advise the applicant contact person that plan chec:u has been completed. @I Zsqil staff - did advise applicant that the plan chec:c has been completed. person contacted: fldytzdr no vce- Date contacted: " Telephone = 43Y-6 255 0 REIGiXKS : PLAN CHECK NO: w- 957 JURISDICTION: CITY OF CARLSBAD ENCLOSURES: FLOOR AREA: / 6 ###' STORIES : 724 0 HEIGHT: - REMARKS: - PLAN CORRECTION SHEET CITY OF CARLSBAD SINGLE FAMILY AND DUPLEX DWELLINGS Date plans received by jurisdiction: E3 -4-9y Date plans receivedby Esgil Corporation: FOREWORD: PLEASE READ requirements contaised in the Uniform Plan check is limiired to technical Building CoBe, Unifcrm FluTbing Code, Uniform Mechanical Code, rational Electrical Coda and sczce 1a.h'~ recnlsting energy conservaticn, r.oise actexation and access for tke tar.5Lcagred. ??.e plan check is based cn reqJlacicxs enforced by may have other ccrrecriox sased cn laws the Euilding Inssecticn 3eparir.er.c. You and ordinances ky the ?laming other departmer.ts. Departnent, sncl~.eeri?g 3e;ar:-.er.: or Present California lzw mar.dztes that Title 24 and tP.e fol1cxir.g r,odel codes: residential constrccticn ccrtc:y with -. The above regla-,icns apply to residential conscrccticn, regardless of the code editions a.dc>ted by crdi-ace. The circled ite7.s clarification, modification or change. listed need All items have to be satisfied before the plans will be in conformance with the cited codes end reFJlations. Fer Sec. approval of the plans does r!ot perzit the 303(c), 1591 Uniforz 3uilding Code, the violation of any state, councy or city law. To soeed UD the recheck Drocess. note on this list (or a CODV) where each correction item has baen addressed i.e.. €3-5-94 Date initial plan check completed: B-/o-qy ay : et #rd AA+-~~ Applicant contact person: 0 ye6 Telephone:" L/3v- 61254 to enclose the marked UD list when vou plan sheet. soecification. etc. 3e sure submit the revised ~lans. NOTE: PhGE NUHBERS hRF. NOT IN SEQUENCE I\s PhGES lUWG NO ITEMS NEEDING CORRECTIONS hZXE DELETED. List No. 2. Carlsbad Single Family Lkelling and hplex With All Supplement.. 11991 L3C) pLANs original tracings and scbmit txo new Please mke all corrections on the sets of prints. to: Zssil Corpsration, 9325 Chesapeake Drive, Suite +!208, San Dieso. California 92123, (619) 550-1463. o+@ ?lease -ake all corrections on the criainal :racings and s.5nit two new P- / P - - sets of ~rints, to: The jcrisdiction's building departxezc. Indicate cn the Title Sheet of the plans tke za7:e of the legal o~er and rime of ::e ~srscn ressszsible for the preparation of tke plans. Section 302(a)7. All sheers of plans mcst be siczed by the person responsible for their preparation. (Caiifornia 3usiness and Irofessiczs Code). Plans, specificetions axicalculations shall be si~ned end sealed by the Californis state licensed enoiceer or preparation. for plans deviating from architec: responsible for their conventional wood fraae construction. Specify ex+retion date of license. Code) . (Califorzia 3csiness and Frofessions P Submit fully diir,ensicr.ed plot plan, drawn to scale, shoring location, proposed structures cn che lot. size, and uses of all existing and 1den:lfy prcperty lires end show lot dime?.sicns and all eas?.i;ienis. Seccion 302 (d) . p. - lnalc--a .' =i- distezce frcn Froperty lines to c?.e troscsed builcirc. Section 302 (dl . f. On ::?e __.__ E+=-- specify a?y iter.3 recyiirir.: s?ecial Cn-'-- -..--L cf :he plans, ins?ecticn, in 3 fcrr,ar srxlar io thaz sho.xn belcr. Eectic- 332 (c) . .. inscecticns, =?e fcllcwi?= checked Specify on the Title Sheet of the ' plans the gross floor area of each element of this project, including SPXIPL YACG?JXY dwelling, carace, carpor:, patio, deck and balcony. Section 302(d). SP:&YED-ON 71x2 0 Pfovide a statement on the Title Sheet 01 the plans tha: this project shall PILtS/CAISSNS WLC and UPC and 1950 XZC. comply with Title 24 and the 1991 Uac, EXFJZ3SION PXCX!~S PROOFING DESIGVS3.-SPECI?iSD 11/18/93 2 f. Shew cn the title sheet all structures, pools. walls. etc. MY pqrcion of the project shown on included xnder this application. the sic+ plan chat is not included with the buiidizg permii application filed s:lc.~ld ce clearly identified 5s "nor. izclude3. " Cl-": .=--y s:-.c.z lr the Icxer level is ._ a b~serrer.: or e story, 'cased cn the definizions in Secticns 403 and 420. ?lo; finish Grade (as defined; o?. elevaticzs ar.6 Eizensicn the C~SCBT.C~ :o c5e floor ebsve, for SfOTJ Ceternixcion. .. ?I33 PROTZCTION j. ~xteri:? walls closer t5~n 3 feet to pro-cezr.-~ lims snall ce one-hour rated cczstr-tcion ar.d have no ooeni2cs. Table 5-3. - )A. zxc""- --v4-- walis clcser then 3 feet to a prcpercy line shall have 30 inch oeraptts w:he.n the flcor area per floor exceeds I, 000 spare feet. See sectior! 1710 for possible exception. Projeccions, including eaves. may not extend more ihan 12 inches into ii-.e 3 foct setback from the property line. Section 504 (D) . Eaves 0-ier required windcws shall be id not less than 30 inches from the side and rear property lines. Section 504 (a). . Projections, including eaves, shall / be one-hour fire-resistive construction, neavy tirrber or of noncorrbustible material if they projeci into the 3' setback area from t2e property line. Section 1711. Dlastic skylishts shall not be roof located within a distance to Installed within that portion of a property line where openings in exterior walls are prohibited or required to ke protected. Section 5207 (a) 7. Show locations of permanently wired smcke detectors with battery backup: GSNEX- RZSIDSNTIAL REOUIRXKENTS . liabitable rams , kitchens, skll ccniein ec leasz 70 ot:her than sqdare ieei of flcor area. At leasi one roam shall have ncc less than 120 square feet of floor area. Section 1207 (b) . P 7 . No habitable roc-, oiter than a kitchen, shall be less iksn 7'0" in any dimension. Seccion 1207 (c) . . Sleeging rooms sbll have a window or exterior door fcr enerzency exit. Sill heighi shall .nor exceed 44" above the floor. The window =est have an openable area of at least 5.7 square fee: with ihe minimrn openable widch 20" end =;?e minimum oper.able heighi 24". Seccion 1204. 4. Basements in dwelling Lnits shall comly with the above (even if not desianated as sleepin? roox) . Section 1204. J :c 11/16/93 3 windcsr area rust be et least 1/10 of the floor area 2r.d a minimum of 10 square feet per Section 1205 (b) . Appears to be deficient in c?pza%l+ xizdcw area in habitable r0cr.s -2s: ke 1/20 cf the flcor area and a -i-i-.. ..__ J of 5 socare feet. In zosr,s, lj;S or' area is required and - ..-Lcr.s, la>~njry room and similar n1~1z-23 is 1.5 SF. ft. Section 1205 (c) . At Itas: 1j2 of tke ccrccn wall must than 25 s;. fz., nor cze tenth of the flccr area cf the izterior room, Secticn lit5 (a). st;?liei frcn an adjacent room. xeqJ1rea windcws shall not open into a rccfed porch unless the ceiling celght is at least 7 feet, the loncer side is at lees: 65% open, or comt. azd the psrch a3cts a street, yard Sec:ion 1205 (a). Provide xechanical \-entilation capable of providing five air changes per hour in bathrcoms, water closet cozpartxents, lacndry rooms and similar rooms if required opezable windows are not provided. Section 1205 (c) . Note tkt the discharse point for exhaust air will be at least 3 feet frcm azy opening into the building. Section 1205 (c) . Ductless fans cannot De used in bathrooms if a tub or shower is present. Section 1205(c). b;t'--. .. .. be c;tn a:= :Eve an openizg not less if light ar7.i ventilrtien is being - .. .. Shcw that ceiling height for habitable rooms is a minimum of 7'6". Section 1207 (a). Show ceiling heioht for laundry bathrooms is a minimurn of 7'0". roocs, hallways, corridors, and Section 1207 (a). on tt.e plans 30" clear water clcset cc.xpartments and i<- clearance in front of water clcset. Secticn 511 (a). Shw safety cltzizo in the following locazi0r.s. ;e- sec:icn 542s (d) : a. ;?ere the ?ear?st edge cf olezing is ..i"" *-L..-n 3 24-i"' side cf a t22zr :n a clcsfi ..-n arc of ei::-.er ,-:2LAcn (cr.ltss tker? is an :"=-\:e-,?-.- ..-1: i=-.*.=" ______ ..L.., +=-- ___ the dczr a:.? tk2 glazizg cr 21 ;?.e g1azir.g :i j,.cJ" c.T :.:c:$r 55ove A=:sl:Js s-rfcct). .. ._ .. . - . .- " .. . b. Glazing grtarer zhn 9 spar? I--- w>zA7 tt.5 5c:tcz edge less 15" abcve t:-.? ZLGC~ and tke -;TJ edse crearfr ;:?an 35" 6bcx-e -.-= flocr (2-less the glazing is fzcr, ~alkir.g scrfaces or 11 a cr.plying ?rctective bar is Lzs:alled). c. Glazing in s:-.c'xEr and cub ezclcsures (inclcding windzxs *lLhin 5 fee: cf tub 'ir showr flcor) . .. "" "_ -_ " _. -"= ~ L..C.. 35" >.=rizc?;ally ,a;w.y ... - Walls and floors sezaratizg units in resistive construction. Provide details of the assezblies. Secticn 1202 (5) . . Anezzanine is an interrediate floor and nay not have a floor area exceeding 33 1/3 percent of the total floor area in the room below. The nezzanine floor mcst have a clear heioht of 7 feet, above and belcw. and must have the long siee posts end protective walls cr open to the rocn below except for railings not exceeding 44" in heiskt. Section 1717. . The loft you shcw does not comply as a mezzanine floor and is, by Uniform Buil5ing Code definition, a story. Secticn 1717. ' 12 children shzll comply with the 9. Dwellings csed for daycare for 7 to special requirenents in Chapter 12 of Title 24. Exterior stairways shall not project into the 3 foot setback from the property lines. Section 3306 (m). he walls and soffits of the enclosedcsable space ucder interior stairs shall be prctected on the enclcsed side as reTJired for one- hour fire-resistive cccstruction. Secticn 32C6 (1). ~l~-,-.. cnits, show tht corridors .-.-.-;- be..re 2 -ini~,xrn width cf 36 inches. Secticn j3C5 (b) . 4001ING specify roof slope xoof slqe is nct adeqdete for roof type s;ecified. Table 22-3, 3 and 7 d. Specify roof material and agplicaticn. Cnapter 32. Specify I.C.3.0. or U.L. approval nurrber for roof materials not covered in iT.3.C., 2.9.. tile, etc. Sectioa 107. Specify xinimurn 1/C inch per foot roof slc2e for drainage or design to suppori accumulated water. Section 3207 (a) and Section 2305 (f). @ Show. roof drains and overflows. fi Provide skvliaht details to show Sect103 3207. 3%lt&l Hcdlzo#4ac A-s w compliance -wi<h Sections 3401 and 5207 or provide I.C.3.0. approval number. f. Plastic skylights must be separated fron each other by at least 4 feet, unless they are over the same room and their combined area does not exceed 1CO square feet (or 200 square feet if the plastic is a “CCI“ Gaterial). Section 5207 (a) 6. pd Show attic ventilation. Minimum vent area is 1/150 of attic area (or 1/300 of attic area if at least 50% of the required vent is at least 3 feet above eave vents or cornice vents). Show area required and area provided. Section 3205 (c). ,f. Note on the plans: “Attic ventilation openincs shall be covered with corrosion-resistant metal x.esh with mesh openings of 1/4-inch in dinension.“ Secticn 3205 (c) . CCNCRE’i3 LSD Y-XSOhTY _. details or ncse construcsion to ‘c? FroviCt zl.re?lace cc?.structicn per ezteched fire?lece standerci dra. .: -- c?.eg:er 37. scFport a::s to wood ix Seiszic Zcnos 3 and 4, cor+ly with Secticx 3006 (d)l axi Secticn 2515 horizcz;el joinss, ecc. (a), Shcx cies end $9 wire in . Shw hsight axi ccnstructicn details of all zasozry walls. C:-..apters 2: and 25. . Shod floor azd roof connections to mascnry and. ccncrete walls. per lizeal foot or ti.e actcal desig Conzection shall resist 200 poiincs grein tension or bending in wmd load, xhichever is greater. Crcss 2310. ledgers is not permittee. Secticn GARAGE AND -PORTS Garace requires one-hour fire protectioa on the Garas? side of walls and ceilino common to the dwelling. Table 5-3, Section 503 (d) . All elements supporting flcor above garage, including walls supporting flocr joists, must tzve one-hour fire-resistive protection on the garaqe side. Section 503 (b) Show a self-closing door, either 1- 3/8* solid core or a listed 20- minute assembly, for openings betxeen garage and dwelling. Section 503 (6). r”” into a room used for sleeping Garages are not permitted to open purposes. Section 1104. 11/17/93 ~ 5 Pn occvpancy separation is not required between carport and residence. provided the carport is open on two or more sides and has no enclose5 uses above. Section 503 (2) Sxctstion 3. St.cm garage framing sections, size of lateral cxss bracing at plate line, --=- over Garage opening, zetbod 5rackg garage front and hcld?cxr.s i: recpired. C:;apter 23. XEE: ?!ax<xn shear rar.tl height-to- width rario is 3-1/2 to 1 for plyas?. Table 25-1. Dosrs 7.3'11 sstn into the Garage only lr t>= floc or lacding in the ~ara~s is zct more than one inch seccicn 33cc (i). Io-rer ::a? the 6scr threshold. ._ . 0 Frcvide an 18" raised platforn for any FXJ, water heaier, or other device in the garage which may ge.zer+te a flame or s3erk. LXC Secciox 5ca. iT?C Section 1310 (a). POrnATION REOUIilE?EXTS Per soils report, note on the plan the soils classification, whether or noi the soil is expansive and note tht allowable bearing value. Seccion 2505 (c). /6- The foundation plan does not comply with the soils report recoTmendaiions for this project. Please zeview the report and modify desi-, notes and details as required to show compliance:- /?. The soils engineer recormended that he/she review the foundation plan that "Prior to the contractor excavations. Note on the foundation requesting a Suilding Department ioundacion inspection, the soils engineer shall advise tt,e building official in writing that: 1. The building pad was prepared in accordance with the soils report, stee;ctss and heights of cuts and rliZs. Chzpter 29. d4. Note cn D~E~S that wood shall be 6" . Note cn plans that surface water will drain away fron building and show drainace patcern and key elevetioils. Section 2905 (f) . Dizension foundaricn per L7.a.C. TaS1e 29.q: 1 6" 2 12" 12" 8" 15" 18'' 6" 7" 3 10" 18" ?A'' 8" 'Foundaticzs may support a roof in addition ts the floors. Where orly a roof is s*:cported, use foundation for one floor. Shod foundation sills to be pressure treated, or equal. Section 2516 (c) 3. Show fomda:ion bolt size and spacing. Seccion 2907 (f). Specify size. I.C.B.O. number and manufacturer of power driven pins ad exsz-sicn anchors. Show edge and ezd 2istances and spacing. secticn 232 (6). and 1csatic.n of hold doxn anchors on reFdired, shcw size, erbednent fo~ndaticn plan. Secticn 202 (d) . plax t::s~ ?old dcm anckors nus: 02 LE sold 2sxzs are required, note on tied in ?:lace prior to fouzdation ;?<-"-:" z-ii-C... Secticn 3CS (e) 1. 'ceari~s xclls and shsar walls. shcw e:q:a~e footincs under all Sectizn iSi7 (3). " " . skw c? the plans .details for F- -L=-r- -c-cs ="- -,uLincs steeper than 1:10. SecLion is37 (c) . Shor -:-?:-.. gfade to bottom of floor joists and L,A:.A,.lL~ 18" clearance from mxiz:n 12" clearance to bottom of girders. Section 2515 (c) 2. Show pier size, spacing and depth into =-disturbed soil. Table 29-A. Show ninimum underfloor access of 18' x 24'. Section 2515 (c)2. Show minimum underfloor ventilation equal to 1 sq. ft. for each 150 sq. ft. of underfloor area. openings practical and shall provide cross shall be as close to corners as ventilation on at least two approximately opposite sides. Section 2516 (c) 5. In 2-srcry buildincs, shear panels at the first story (at least 48 inches in width) shall be located at each t?d or as near thereto as possi'cle and co7,prise at leas: 25 perc2r.z cf :he linear length of the wall, zr prcvide -__ ;=sj2n. Secticn 2517 (;: i, Table is-V. fl. Note .c:css bri2ci-g cr blocking. ?locr joists a-d rafters 12" or more i- dept:? s'r;all be suppsrtej. lacara~~y by cridGi:.? at intervals not =,.-=e edces 5:s k.eli inlir.2. Sec. 2305 clr? 2 fze:, 1:-less bcth (h) . .. .. . Shcw 2lcciiir.g a: ends ani a: sc~xr~s of flcor joists, rafters . ~earir.; partitions, zerpendicular suppcrzing clroers, beazs, walls or partitions, r8:13re than the depth of the jcisr. Section 2517 (d) 5. to joiszs, skali 7.0: 5s offset frcx .. /Lb; td 0 0 . Show rzfter ties. Rafter ties shall be scaced n3t nore than 4 feet CT? cencer and be just above the ceiling joists, where rafters parallel. Section 2517 (h) 5. and ceiling joists are not 4. Show rafter Furlin braces to be not less than 4S degrees to the horizcztal. Sectioa 2517 (h) 5. 105 Show dmble top plate with minimdm 48" la? splice. Section 2517 (g) 2. 105. Show zailino will be in compliance - with Table 25-4. PWiMING U 107. Show or note fire stops at the following locations per Section 2515 (f): Shcw wall bracing. Every exterior wood s:ud wall and main cross-stud partition shall be braced at each end ac least every 25 feet of length xslls and partitions, including In concealed spaces of stud with 1 x 4 diagonal let-in braces or equivalent. Section 2517 (g) 3, and floor levels and at 10 foot :-rred spaces, at the ceiling hcrizontal; ir;tervals both vertical and Table 25-V. _* 11/17/53 .. 0 b. .x all interconnections between ccncealed vertical horizontal spaces such as occur and at soffits, drop ceilings and c. I? concealed spaces between cove ceilings; szair stringers at the top and tcctcm of the rcn and between sxds along and inline with the c26er -9'1 of stairs if :?.e walls the c:fi>ished; stairs are d. 12 oseninss aromd vents, chi-neys, *..-c.n afford a assa age for fire a: ceili?g and floor levels, t. .x c;snincs between attic nonconimstible materials. s;cces an5 chimey chases for "" LGLLczy-bui1t chimeys. - -. "-" _. , ducts, -. ,"-,laces and similar cpeniccs . ..II. .. . ... - 12 d?lp1exes, draft stcps shall be proviCtd in floor-ceiling walls separating units and esse7bb:ies and attics in line with Section 2516 (f) 4. separating unics from comon areas. 7- P . Show stud size and ssacing. Xaxinun allowable stud heights: Bearing wall: 2 x4 and 2 x 6 max. 10'; Non-bearing: 2 x 4 max. 14', 2 x 5 aa. 20'. Table 25-3-3. . Studs -.upporting two floors, a roof and ceiling must be 3 x 4 or 2 x 6 at 15" O.C. Table 25-R-3. $. Note on the plans that an A.I.T.C. Certificate of Compliance for glued laminated wood members shall be given to the building inspector prior to installation. Section 2505. Detail all post-to-beam and post- to-footing connections and reference the detail to the plan. Section 2515 (ml . Detail shear transfer connections, including roof and floor iiaphragms. Section 2513. to shear walls. 9. SECZ~CX 502 (d) . . Saeci?~ all header sizes for csexizss over 4' wide. Section 2517 (g) 5. Frovide celculations for mei? vertical and horizontal framino nczbers 2nd footings. Section 302 (Dl. Provide calculations for lateral loads, shear panels, shear transfer and related. Section 302 (b) . P . in Seismic Zones 3 and 4, the allowable sheer wall values for drywall in Table 47-1 must be reduced 50 percent when considering etrthcpake loads. This does not apply t3 wind loads. Footnote 1. , Shm cn the plans all structural requirenents developed in the strccturel calculations. Section 302 (dl. (See comnents below or at end. 1 . Colurr-?s and posts located on concrete or masonry floors or decks exposed fo the weather or to water splash cr in basements and which be suxcrted by concrete piers or suppors sermanent structures shall netal Sedestals projecting 1" mini-.;x abwe floors Enless appro:'ed mod of natural resiscance to decry cr treated wood is used. Sectic- 2515 fc) 4. _- y4 ~no~vi~:al ccncrete cr msonry plers skall project at least 8 the czlx;~~?s or posts which they ~ncnes eSove exposed ground unless sussors are of approved woad of natural zesiscance to decay or treated waod is used. Sectien 2516 (c) 4. .. p- shcw lccaricn of attic access with a ml~!ix3 size of 22"x30n, unless the rzxiw~n vertical headroon heishc in the attic is less than 30". .&zcess must be provided to each se;areeed attic area, shall be locateS in a hallway or other headroc3 clearance is required readily accessible location and 30" above the opening. Section 3205 (a) . F . Detail CFJSS layout for 30" x 30" attic access, if required for eFipzeac in the attic and detail 30" x 30" clearance through truss webs - 128. Specify plywood and/or particle board thickness, grade and panel span rating. Table 25-S. When roof pitch is less than 3:12. desicn ridge as a.beam. Section 2517 (h). /. P 1 0. Ridges, hips, and valleys shall be at least one size larger than supported rafters. Section 2517 (h) 3. . In open beam construction, provide strap ties across the beams at the ridge support. Section 2501 (b). are less than 14" high, framing If fotxdation cripple wall studs shall be solid blocking, or sheathed with plydood. Section 2517 (g) 4. p. CriF21e %all sz-di exceeding 4 fee: or i inches 5y 5 inches ,*.hen In .-.ei:hc shall k= 3 ixn by 4 inch sucecrting 2 szcrlei. Seccion 2517 (9) c. . Noze on the ~1ar.s thac "all werz.:tr-expcse9 s.1rfeCes shall k.a-22 a xesthtr-resistive 'carrier eo prcrecz che inisrior wall csverir.3 and skat extericr caenings shall be flastod in such a zancer as to nake the;r, veaek.erprcof". Section 1708. KECILANIGL (TNIPOXW I.%CFJ-VICAL CODE) All heating, ventilating, and cooling systems azd appliancts shall corgly wiih the Unifc--& Xechanical Cede. Shcx ;he size, location and type of all :-.teeing and coo1ir.g appliances or syscems . If. Eve-[- eoll;ng, un,it _shall, ,be provlzeo wltn neatlag racllitles capable of maintaining a roon te""- ..t,--~tur= of 70 degrees F. at 3 feet abovo tho floor in all habitable rooms. Show basis for cozsliance. bac. Sec. 1212. . Note on the plans that the FAiT closet or alcove must be 12 inches wider than the furnace or furnaces beir.5 installed. D:C Section 704. Show minimum 30" deep unobstructed working space in front of furnace. Section 505, LXC. . Furnace shall not be installed in any bedroom, bathroon or in a closet or confined space with access only throuch such room unless specified as direct vent appliance, enclosed furnace or electric heating appliance. Secticn 704, WC. . Show source of combustion air to furnace, per Chapter 6, UMC. 11/17/93 >< 10 Show on the plan that ground-fault circuit-interrupter protection complies with 1990 NX Art. 210-8, which reads as follows: All 125-volt, single-;:?ase, 15- and bathrocxs, 20- anptre receptacles ifistalled in outdoors and wichin 5 feet cf a Garages, oasezents, kitchen sink. PLUMSINS (LWIF'OXV PLWING CO3X) Show .dater heater size, t)r,e and locaticn cn plans. ZC, Section 1301. 1 ;i" P td /" P 1-3. xote cn t?.e plax tkat "cc752stion air for fuel burnino xater koacers will be srovieed in acccrdance with the Enifera Ilc~bing CoEe". Fuel cc~2ustion water keacer shall not be installed in clothes closets, in a bathroon or bedrocm. or in a closet csening into bathroom or bedroom. UPC, Section . - 1509. 1 7. Provide adeqate barrier to protect , water heater from vehicle danage. An 18" platform for the water heater does not satisfy this requirement. USC, Section 1310. 8. Show T and P valve on water heater and show route of discharge line to exterior. UPC, Section 1007 (e). 9. Show that water heater is adequately braced to resist seismic forces. UPC, Section 1310. 1 0. Show shower stall can accommodate a 30" circle and has a minimum floor area of 1,024 sq. in. UPC SO9 (d). . New water closets and associated flushoneter valves, if any, shall use no more than 1.6 gallons per flush and shall meet performance standards established by the American Kational Standards urinals and associated flushometer Institute Standard A112.19.2, and valves, if any, shall use no more than one gallon per flush and shall meet performance standards established by the American National Standards Standard A112.19.2. H 5. S Code, Institute Section 17921.3 (b) . tB Y NOISE INSULATION (DUPLEX-FSL 2. Show details cf d-plex comxn (party) walls axi flccr/ceilir.g asserblies to ac~-=ve a So~r.5 Transnission Class !S?C) rising in walls of 50 decibe1s and an Iinpacs Insu?a:ion Class IIIC) ra:ir.g cz floor/ceiling cf 50 teeibels. Title 24. .. ." . Shosr hew penetrasiczs cf asserblies for piping, electrical tevices, recessed ccbin.ets, kzshtubs, soffits, or heatir.3 yentile:ing, cr exhaust ducts s::all be sealed, lined, or insulace5 to rraintaiz Title 24. required sound trazszission rating. 4 4. Provide insulation in .dalls azi cei1ir.g to achieve S7C of 50 between garace and living area if garage use is not controlled by resident. Title 24. EXERGY CONSERVATION NOTE: Plans submitted after Zenuary 1, standards. 1993 must comply with the z.sw ener9 165 Provide plans, calculaticzs and worksheets to show compliance with current enerw standards. 0 0 166. The re-lations require a properly completed and properly signed Form CF-1R to be either imprinted on the plans, taped to the plans or "sticky backed" on the plans, to allow the building inspector to readily compare the actual construction with the requirements of the approved enerw design. 167. All energy items shcwn on the plans must be in agreement with the information shown on the properly completed Form CF-1X. 0 11/17/93 12 0 i73. Specify on the buildins olans all of the mandatory energy conservation requirements as listed on the enclosure titled, mu.*- ,..cndatorv Measures Checklist. ’’ Show the make. model and efficiency of the space heating [CY coo ling) system. For cczpliance with the energy rcon additions, show stacdards. See attached. provide fluorescent general kitcten(s) and bathroom. 1igktiRq (40 lumens per watt) in - 2rcvida a note on the plans stating “All new glazing (fenescrations) will be installed wic:? a certifying label attached, s?cxing the U-value. cxasam s .a .D. .G DUPLEX SUPPLEMENT zxrw conservation design should be for Zone 7. For gas piping under slabs that the attached Policy 91-46 for serve kitchen island cooktops, see special sleeve and clean-out rebyirexents. h’ew residential units must be pre- plupbed for future solar water heating. Kote that two roof jacks mcst be installed where the water heater is in the one story garage and directly below the most south facing roof (City Ordinance No. 6093). Note that two 3/4“ copper pipes must be installed to the most convenient future solar panel location when the water heater is not in a one story garage and is not directly below the most south facing roof. (City Ordinance No. 6093). All piping for present or future solar water heating must be not heated or cooled by mechanical insulated when in areas that are means (city policy). Incorporate the waterproofing details, on the attached Policy occurs below grade at the masonry 80-8. where interior living space wall(s). Shosi on the Title Sheet on the p1ar.s. the information required by the attached Developmental Services Sheet 112383. All new residential buildings, inclciing additions, requlre a soi;s report. Please submit two cocles. Exception: If a rocm addition is limited to one story and 1000 sq. ft. in area, then a soils report is not required. ~scil Coruoration will advise the icy to ;lace their soils notice star? on the plans. All scructures require a Class 3 roof covering, except roca addicions. If a roon addition builCing (2nd story addition), covers all of the existkg the? che above exception doesn‘ c appiy . City ordinance 9792 requires two parking- spaces/unit with clear are3 or 20’x20‘ 1.e. no washing machir.es, etc. Show compliance. Overflow roof drains shall terr2x.te in an area where they will be readily visible and will not case damage to the building. ~ ~~~~ ~~ If che roof- drain terminates throcgh a wall, the overflow drain shall terminate 12” minimum above the roof drain. Policy @4-35. MISCELLANEOUS Please see additional corrections, or renarks, on the following page. To speed up the recheck process, note on this list (or a copy) where each correction item has been addressed, 1.e.. plan sheet, note or detail number, calculation page, etc. Please indicate here if any chances have been made to the plang that are not a result of corrections from this list. If briefly describe them and where there are other changes, please they a?e located in the plans. Have chanaes been made to the ~~~~~~ plans not resulting ~ from this correction list? Please indicate: ” ~ Yes NO 11/30/93 /. 13 The City of Carlsbad has contracted with Esgil Corporation located at 9320 Chesapeake Drive, Suite 208, San Dieqo, Califbrnia ' 92123; telephone number-of K191560-1468. to Derforrn the ulan check ~~ ~~. ~ ~~ for your projecc. If you- have any questions regarding these plan them itep, please contact A at Esgil Corporation. L Lrd Adb4Uvr CAL ~ 11/19/93 14 EGRGY REQUIREMENTS FOR RESIDENTIAL ROOM ADDITIONS - CLIVATE ZONE 7 Floor Area of Room Addition CO:??OXZ:NT <loo ft' 100-499 ft' 500-SS9 ft' .loo0 ft' IXStiLATIOX c2ilir.g 2- 19 2-23 3-59 ?.:a11 2-13 2-12 Z-12 Flocr 2- 13 2-19 2-19 .55' Zeg . 1. ?lease note that some metal-frame windows may not satisfy tke ii-value requirement of 0.75. ?or additions and alterations only, dual glazed "Greenhouse" windows and skylichts my be assumed to meet this requirement. 2. 2Cb of added floor area plus the area of any glazing removed %cause of the addition. 3. A coefficient of.0.66 will be assumed to be provided when dual glazing is used. 4. If the addition will be on top of existing construction, and: (a)If the addition has conditioned area below all portions, then no thermal mass is required. (b) If the eddition will be over non-conditioned area (partially cr wholly) in a building mostly of raised-floor construction (after the addition), then thermal mass is required spacel. This may be provided by showing a 2" concrete slab et hearths, countertops. in the addition (equal to 5% of the area of the addition that is over non-conditioned etc. grade construction (after the addition), then no therm51 mass is required. (c)If the addition will be over non-conditioned area in a building mostly of slab-on- If the addition will be at the ground floor, and: (a)If the addition will be in a building mostly of raised-floor construction (after the addition), then thermal mass is required in the addition (equal to 59. of the added conditioned footorint area). This may be provided by shoving a 2" concrete slab at hearths, counteriops, etc. (b)If the addition will be in a buildinq mostly of slab-on-grade construction (after the addition), then thermal mass is requcred in-the addition Iequal to 20% of the added conditioned slab-on-grade floor area). This may be provided by covering a portion Of the slab-on-grade with tile, wood, etc. 5. If the existing system will be utilized (if no additional systems are needed to provide UBC heating requirements), there are no special requirents, other than mandatory insulation for any extended ducts, etc. 6. If the total number of water heaters increases in the residence, then calculations PnUSI; be submitted to show that the,,entire existing-plus-addition system meets the waLer heating energy budget. 9-93 ER-RA7 51dg. Dept. 0 Esgil Building Pernit fee S- /7/.*0 s Plan Check fee 5 ///. 15 J .. COHHENTS: .- SHEET OF 12/87 DATE:M<h.~ BUILD G DDRESS: 2 0 /?CdJA &e PROJECT DESCRIPTION: APP I&<@ RCrT,dP4fM BUILDING PIANCHECK CHECKLIST PLANCHECK NO. CB %- ~9757 ASSESSORS PARCEL NUMBER: dr S- 4Q/ - / EST. VALUE 00 ENGINEERING DEPARTMENT APPROVAL me item you have submmed tor review has been epprwed. me approval Is besed on plans, informatbn andlorspecifications prwiw in your submmai; therefore any changes to these items afler this date, including field modifications, must be reviewed by this office to insure continued conformance with applicable codes. Please review carefully ail comments allached, as failure to comply with instructions in this report can result in suspension d permit to build. 0 A Right-of-Way permit is required priorto construction d the following improvements: DENIAL please sea the anached rem d Mciencies marked with Make neceswy corrections to plans or specifications fur ccinpllance with applicable codes and standards. Submit corrected plans and/or specitications to this office for review. By: Date: By: Date: By: Date: 0 Dedlcatlon ~pplication 0 DedIcatlMl Chwkllst I 0 lmprwement ~pp~lcat~on ! 0 lmprwement checklist NAME: 0 Future lmprwement Agreement Ctlydcarfabad 0 Grading Permit Application 0 Grading SubmW Checklist RigM d Way Permil Application 0 RigM of Way Permit Submmal Checklist 0 Sewer Fee lnfmion Sheet A4 I and lnfonncaion Sheet P\DOCSCHKLST\BW00l.FRM REVWtIB4 2075 Las Paimas Dr. - Carlsbad, CA 92009-1576 - (619) 438-1161 - FAX (619) 438-0894 @ . BUILDING PLANCHECK CHECKLIST SITE PIAN / 1. 2. 3. 4. Provide a fully dimensioned site plan drawn to scale. Show: A. North Arrow B. Existing 8 Proposed Structures E. Easements C. Existing Street Improvements F. Right-of-way Width & Adjacent Streets Show on site plan: A. Drainage Patterns C. Existing Topography B. Existing & Proposed Slopes D. Property Lines Easements Include note: "Surface water to be directed away from the building foundation at a 2% gradient for no less than 5' or 2/3 the distance to the property line (whichever is less).' [Per 1985 UBC 2907(d)5]. On graded sites, the top of any exterior foundation shall extend above the elevation of the street gutter at point of discharge or the inlet of an approved drainage device a minimum of 12 inches plus two percent" (per 1990 UBC 2907(d)5.). Include on title sheet A. Site address B. Assessor's Parcel Number C. Legal Description For commercialfindustrial buildings and tenant improvement projects, include: Total building square footage with the square footage for each different use, existing sewer permits showing square footage of different uses (manufacturing, warehouse, office, etc.) previously approved. MISTING PERMIT NUMBER DESCRIPTION Pel64 BUILDING PCANCHECK CHECKLIST DlSCRmO NARY APPROVAL COMPLIANCE 0 0 5. Project does not comply with the following Engineering 'Conditions of approval for .. Project NO. Conditions were complied with by: Date: DEDICATION REQUIREMENTS 0 6. Dedication for all street Rights-of-way adjacent to the building site and any storm drain or utility easements on the building site is required for all new buildings and for remodels with a value at or exceeding $ pursuant to Code Section 18.40.030. Dedication required as follows: 0 ~~ Attached please find an application form and submittal checklist for the dedication process. Provide the completed application form and the requirements on the checklist at the time of resubmittal. Dedication completed by Date: IMPROVEMENT REQUIREMENTS 7a. All needed public improvements upon and adjacent to the building site must be constructed at time of building construction whenever the value of the construction exceeds pursuant to Code Section 18.40.040. Public improvements required as follows: Please have a registered CMI Engineer prepare appropriate improvement plans and submit them together with the requirements on the attached checklist for a separate plancheck process through the Engineering Department. Improvement plans must be approved, appropriate securities posted and fees paid prior to issuance of permit. Attached please find an application form and submittal checklist for the public improvements requirements. Provide the completed application form and the requirements on the checklist at the time of resubmittal. Improvement Plans signed by: Date: Pfig%2#4 REV05111194 BUILDING PLANCHECK CHECKLIST 00 0 lstJ 2ndJ 3rdd 7b. Construction of the public improvements may be deferred pursuant to code Section properly and processing fee of $ 18.40. Please submit a recent properly title report or current grant deed on the so we may prepare the necessary Future Improvement Agreement. This agreement must be signed, notarized and approved by the City prior to issuance of a Building Permit. Future public improvements required as follows: 00 0 00 0 uno do .o Improvement Plans signed by: Date: 7c. Enclosed please find your Future Improvement Agreement. Please return signed and notarized Agreement to the Engineering Department. Future Improvement Agreement completed by: Date: 7d. No Public Improvements required. SPECIAL NOTE: Damaaed or defective improvements found adiacent to buildina site must be repaired to the satisfaction of the Citv Inspector prior to occuoancv. GRADING PERMIT REQUIREMENTS The condtions that invoke the need for a grading permit are found in Section 11.06.030 of the Municipal Code. 8a. Inadequate information available on Site Plan to make a determination on grading requirements. include accurate grading quantities (cut, fili import, export). 8b. Grading Permit required. A separate grading plan prepared by a registered Civil Engineer must be Submitted together with the completed application form attached. NOTE: The Gradina Permit must be issued and rouah aradina approval obtained prior to issuance of a Buiidina Permit. Gradlng Inspector sign off by: Date: 8c. No Grading Permit required. Page3d4 REV WlflFOl f BUILDING PIANCHECK CHECKLIST MtSCELIANEOUS PERMITS 1sW 2ndJ 3rd4 9. A RIGHT-OF-WAY PERMIT is required to do work in City Right-of-way and/or private work adjacent to the public Right-of-way. Types of work include, but are not limited to: street improvements, trees, driveways, tieing into public storm drain, sewer and water utilities. Rightof-Way permit required for A separate Right-of-way permit issued by the Engineering Department is required for the following: 10. A SEWER PERMIT is required concurrent with the building permit issuance. The fee is noted in the fees section on the following page. 11. INDUSTRIAL WASTE PERMIT is required. Applicant must complete Industrial Waste Permit Application Form and submit for Ci approval prior to issuance of a Permit. Industrial waste permit accepted by: Date: Page4d4 REV Wl lloI ENGINEERING DEPARTMENT ENGINEERING REVIEW SECTION FEE CALCULATION WORKSHEET 0 Eslimste baed on UnConRnned Infcmaibn from applicant. 0 calculatkm besed on bulldlllg plan submntal. Address: BICQ. perm# NO. Prepared by: Dale: Checked by: Dale: EDU CALCUI ATIONS: Wt types and square footages tor all uses. Types Or Use: Sq. Fl.: EDU'r: AD1 CALCULATIONS: Us types and square footages fw all uses. Types d Use: Sq. Ft.: mrs: Tual EDU's: TU mrr: Depamern tor amount) WTHIN CFD: reduced Traffic Impad Fee) 0 1.PARK-IN-UEU FEE PARK AREA: FEUUNIT: X NO. UNITS: 0 2.TRAFFIC IMPACT FEE mrs: X FEE/ADT: 0 3. BRIDGE AND THOROUGHFARE FEE mn: X FEE/ADT 0 4. FAClUTlES MANAGEMENT FEE ZONE: sca.Fr.: X FEE/SQ.FT.: 0 5. SEWER FEE PERMK No. EDU's: X FEEEDU: BENEFK AREA: DWNAGE BASIN: EDU's: X FEVEDU 0 6. SEWER LATERAL @?,so0 DEPOSIT) 0 7. WATER FEE EDU's: X FEVEDU: =$ =$ =s =s =s =s =$ =s TOTAL OF ABOVE FEES: $ P\DOCS\YlSFORM~BPFRM REV M/lZ/M PCANNINGCHFLXLIfl Plan chedc N0.94- qS7 ~ddre~ 76 20 I)&%& bk Planner VAN LYNCH Phone 438-1161 em. 4325 APN: 7llf c (/q/ -/0 Type of Project and Use h.) /)eo VAL A)~QI/~zJ/J j (Name) 3 "(* n Zone E-/ Facilities Management Zone 6 ""I . 0". (If property m, complete SPECIAL TAX CALCULA ::la WORKSHEET provided by Building Dep bbb 1,2,3 Number in &le indicates plancheck number where deficiency was identified Compliance with conditions of approval? If not, state conditions which require action. Conditions of Approval / APPROVALJRESO. NO. DATE: PR(XIECX NO. OTHER RELATED CASES. Compliance with conditions .of approval? If not, state conditions which require action. Conditions of Approval / do0 califomiacoastnlcammrsslon .. PermitRequimkYES-N& DATE OF APPROVAL: San Diego Coast District, 3111 Camino Del Rio North, Suite 200, San Diego, CA. 92108-1725 (619) 521-8036 Compliance with conditions of approval? If not, state conditions which require action. Conditions of Approval d 0 hdusionay Housing Fee w: yES - NO bc (Effective date of Inclusionary Housing Ordinance - May 21, 1993.) Site Plan: &a do 2. Provide legal description of property, and assessor's parcel number. A0 1. Setbacks: 1. Provide a fully dimensioned site plan drawn to scale. Show: North arrow, property lines, easements, existing and proposed structures, streets, existing street improvements, right-of-way width, dimensioned setbacks and existing topographical lines. zoning: Front: Required 2Q Shown 2 Int. Side: Required /or Shown Dr Street Side: Required c_ Shown Rear: Required 2Qp Shown I: V60 2. Lot coverage: Rt?quired cy~ShownL@f d6 0 d&uB 3. , Height: Required Shown a& b$ew.if 4. Parking: Spaces Required Shown Guest Spaces Required Shown 0 0 0 Additional Comments PLNCKFRM Type of Project and Use p?p 5. A f 2i* Facilities Management tone uu. pmper~y a cor-te SPECIAL TM CALCULATION ~. . 0-0 ;;; WORKSHEET provided by Building Department.) 411 kggBi &&a 1,2,3 Number in circle indicates planchcck number where deficiency was identified &a EnvMmam talRcviewRequizd YES-NO- dm&.:;: ' . DATE OF COMPLETION Compiiance with conditions of approval? If not, stare conditions which rquire action. conditions of Approval APPROVAVRESO. NO. DAm PROJECT NO. OTHER RELATED CASES Compliance with conditions of appronl? If not, state coditions which rquh action. Conditions of Approval ~corcplcommicdonPamit~YES~N0~ DATE OF APPROVAL. San Diego Coast District, 3111 cpmino Del Rio No* Suite 20, S.n Diego, ch 92108-1725 ComptiPnCe 6th conditions of approval? ~f not, state condidons whi~h require action. Conditions of Approvpl (619) 521-8036 m/o 0 khii~mryHo~~hgFecrql&& Y!3- ./ (Effective date of tnclusionary Housing Ordwnce - May 21, 1993.) NO - , Site Pkn: do a do 0 1. Provide a fully dimensioned site plan drawn to scale. Show: North arrow, property lines, easements, existing and proposed smctures, sweets, ehting street improvements, right-of-way width, dimensioned setbacks and existing ropographical lines. 2. Provide legal description of prom, and assessor's parcel number. 1. Setbacks: Front: Int. Side: Street Side: Rear: 2. Lot coverage: 3. Height: Rquired Required Required Required Rquired Shown rofi 4. Parking: Spaces Required Guest Spaces Rquired - 0 0 [7 Additional Comments OK TO lSSUE AND ENTERED APPROVAL, INTO COMPUTER 9 DATE 9- 25--9$- . . . . . . . . ,. .. . . . . .. .. CERTIFICATION OF COMPLIANCE CITY OF CARLSBAD Plan Check NO.^ 94D 957 DEVELOPMENT PROCESSING SERVICES DIVISION n, I ,-,- . - - 2075 LAS PALMAS DR., CARLSBAD, CA 92009 rcn 73 o &ar (619) 438-1161 4 50 96 This form shall be used to determine the amount of school fees for a project and to verify that the project applicant has complied with the school fee requirements. No building permits for the projects shall be issued until the certification is signed by the appropriate school district and returned to the City of Carlsbad Building Department. SCHOOL DISTRICT: Carlsbad Unified 801 Pine Avenue Carlsbad, CA 92009 (434-0610) Encinitas Union 101 South Rancho Santa Fe Rd. . Encinitas, CA. 92924 (619) 949-4300. - LSan Marcos Unified ,1290 West SanMarcos Blud. San Marcos, CA 92024 (744-4776) - San Dieguito Union High School 710 Encinitas Boulevard Encinitas, CA 92024 (753-6491 1 Project Applicant: P/ Avrn n O&&K<A APN: &-4q/- /roo Project Address: 26 A0 AhVA CT RESIDENTIAL: SQ. FT. of living area 65 number of dwelling units / /lan"- Aodrrifi SQ. FT. of covered area Sa. FT. of garage area COMMERCIAL/ Prepared by Date c/ I&(- " """"""""-j"""""""""~"""""""""""""""""""""""""" FEE CERTIFICATION (To be completed by the School District) Applicant has complied with fee requirement under Government Code 53080 Project is subject to an existing fee agreement Project is exempt from Government Code 53080 Final Mapap roval and construction started before September 1, 1986. (other schoo P fees paid) Other Residential Fee Levied: $ based on -q6,c sq. ft. B 1% 74 st Fee Levied:$ based on sq. ft. B /GL,&& fld I/// /qz Title Dhte" AB 2926 and SB 201 fees are capped at $1. ?2'per square foot for residential. AB 2926 is capped at -28 per square foot for commerciallindustrial. SAN DIEGO (COUNTY) AREA RESIDENTIAL CIRCUIT CARD AND LOAD SUMMARY (1990 NEC) DEPARTMENT OF PLANNING AND LAND USE - CODES DIVISION THIS CARD MUST BE FILLED OUT AND AVAILABLE AT THE SERVICE EQUIPMENT FOR THE ROUGH INSPECTION Service entrance or Feeder conductors: A) Size: No. B) Type: OCU 0 AL C) Insulation: D)ConduitSize:- Servicegroundbond A) Size: No. B)Type:OCU 0 AL C) Clamp location(s): 0 UFER 250 - 81(c) 0 Water Pipe 250 - Sqa), 81(a) 0 Groundrod 250 - 83(c) Branch circuits required: A) Lighting circuits 220 - 3@), 4(d) B) Two small appliance circuits 220 - 4@) C) Laundry circuit 220 - 4(c) D) central heating equipment 422 - 7 Remarks -7 c / (&-i 6 9 2.. BUILDING PERMIT 12/01/95 15:58 Project No: A9401351 PCR No: PCR95066 , Job Address: 2620 ACUNA CT Page 1 of 1 Permit Type: PLAN CHECK.,-REVISION Valuation: Parcel No: 215-431-18-00 0 Development No: Suite: Lot#: 4925 12/@1/85 O@j. $1 Construction T&J: NEW &,-'. "p 1(7 1~ ..".. - .: Occupancy Group: Reference#: Status: ISSUED Description: RELOCATE BREAM, RELOCATE : COLUMN Applied: 11/30/35 Apr/Issue: 12/01/95 Entered By: RMA Appl/Ownr : ROYCE, ROBERT 2356 ROOSEVELT #3 CARLSBAD, CA. 32008 619 434-6253 *x* Fees Required **x llected & Credits x** """"""""""""" Fees : """_"""""""" Adjustments: .00 Total Fees: . 00 103.00 Fee description Ext fee Data """""""""_ Plan Check Revisio _""""""""_ 109.00 CITY OF CARLSBAD 2075 Las Palmas Dr., Carlsbad, CA 92009 (619) 438-1161 11/16/1995 11:35 2087265296 PAGE 01 ROBERT J. BOYCEALA. Licensed C&fomia Architect #lo431 P.O. Box 6720 Ketchurn. Idaho 83340 Phone (208) 726-6666 FAX (208) 7263140 Chuck Traycr FAX (619) 729-5659 11/16/1995 11:35 2087265296 CELLULaRRoNa, PAGE 02 11/08/1995 89:24 2087265296 - PeGE 01 P.O. Box 6720 Ketch- Idaho 83340 Phone (208) 726-6666 FAX (208) 726-3140 Chuck Tnyer FAX (619) IZ9-56J9 BUILOING PERMIT PCR No: PCR95046 11/02/95 11:16 Project No: A9401351 Page 1 of 1 Development No: Permit Type: PLAN CHECK REVISION Parcel No: 215-491-18-00 Lot#: Valuation: 0 Construction Type: NEW Occupancy Group: Reference#: Status: ISSUED Description: 165 SF ADDITIONAL AREA ADDED Applied: 09/14/95 : TO ORIG 165 SF +235 SF ADD=TOTAL OF 565 Apr/Issue: 11/02/95 I Job Address: 2620 ACUNA CT Suite: Entered By: MDP Appl/Ownr : ROYCE, ROBERT 619 434-6259 2956 ROOSEVELT #3 CARLSBAD. CA. 92008 CITY OF CARLSBAD 20'75 Las Palmas Dr., Carlsbad, CA 92009 (619) 438-1161 PERMIT APmcAnoN City of Carla Building Deparbent 2075 Las Palm Dr., Carlsbed. CA PMOP (619) 438-1161 B From Lis1 1 (see back) give de of Permit--: ..................................................... For Residential Proiects Only: From List 2 (see back) give Code of Structure-l&e: Net WGain of Dwelling Units I 2 PR~INFoIuunoN FOR OFFICF. USE ONLY Address unldmg or Sum NO. Nearest Cross Street lot No. Subd~vlston NamdNumber Unit No. Phase No. 0 2 Energy Calcs 0 2 Structural Calcs 0 2 Sails Report 0 1 Addressed Envelope DESCRIPTION 0 WORK PROP USE # OF BATHROOMS 57 $- A NAME (last name first) @ DAY TELEPHONE rc UVWNtH OAG- NAME (last name first) ADDRESS STATE LIC. # LICENSE CLASS (last name tmt) CITY BUSINESS LIC. # an STATE ZIP CODE DAY TELEPHONE STATE LlC. X Relations, or a certificate of Workers' Compensation Insurance by an admitted insurer, or an exact copy or duplicate thereof certified Workers' Cornpensatton Lkclarauon: 1 hereby athrm that 1 have a certltlcate ot consent to self-insure Issued by the ulrector Ot lndustnal by the Director of the insurer thereof filed with the Building Inspection Department (Section 3800, lab. C). INSURANCE COMPANY Cermcate ot Exempuan: I certlry that In the pertormance ot the work lor whlch this permrt IS mued, 1 shall not employ any person In any manner so as to home subject to the Workers' Campensation Laws of California. POLICY NO. EXPIRATION DATE SIGNATURE DATE uwner-nutlaer ~kc~arauon: 1 hereQy attlrm that 1 am exempt trom the contractors ucense law tor the rallowmg reason: 0 I, as owner of the property or my employees with wages as their sole compensation, will do the work and the structure is not Intended or offered far sale (Sec. 7044, Business and Professions Code: The Contractor's License Law does not apply to an owner of property who builds or improves thereon, and who does such work himself or through his own employees, provided that such improvements are not intended or offered for sale. If, however, the building or improvement is sold within one year of completion, the owner-builder will have the burden of proving that he did not build or improve for the purpose of sale.). Code: The Contractor's License Law doe not apply to an owner of property who builds or improves thereon, and contracts for such projects I, as owner of the property, am exclusively contracting with licensed contractors to construct the project (Sec. 7044, Business and Professions with contractor(s) licensed pursuant to the Contractor's License law). 0 I am exempt under Section Business and Professions Code for this reason: 0 YES om 0 NO om 0 NO Is the applicant or future building occupant requid to obtain a permit from the air pollution control district or air quality management district? Is the faciliry to be constructed within 1,000 feet of the outer boundary of a school site? ffANYOF'IHEANSWERSAREYE$ARNAL~~~n?OFOOCUPANCIMAYNOTBE~APIWJULY1,1989UNlffS'IHEAPPlJCANT HAS MET OR IS "LNG 'IHE RIQm OF 'IHE OFFICE OF mGFNN SERVIQS AND THE AIR POLLWITON CONlROL DlSlllICT. 0 NO cuon lendlng agency tor the pertormance of the work tor wnlch thls permrt IS lssued (Sec 30Y70J tin1 UeJ. LENDER'S NAME LENDER'S ADDRESS relating to building construction, 1 hereby authorize representatives of the City of Carlsbad to enter upon the above mentioned property for inspection 1 ceNty that 1 have read the appllcauon and state that the above lntormaum IS correct. 1 agree to comply wlth all Llty ordmances and State law purposes. IAlsoACREE~IOSAVEIND~AND~~'IHE(TIYOFCARISBADACAINSTAU.~~JUM;~oDsls ANDMPFN~WHlMMAYINANYWAY~~AC~STSAID(3nINODN~~CEOF'IHEGRANTINGOF~~. C6HA An OSHA permit is required for excavations over 5'0" deep and demolition or construction of svuctures over 3 stories in height Expiration. Every permit issued by the Building Oficial under the provisions of such permit is suspended or a building or work authorized APPLICANTS SIGNATURE ant PINK: Finance i3 BUILDING PERMIT PCR No: PCR95022 11/02/95 11:15 Project No: A9401351 Page 1 of 1 Development No: Job Address: 2620 ACUNA CT Suite : Permit Type: PLAN CHECK REVISION Parcel No: 215-491-18-00 Lot#: Valuation: 0 Construction Type: NEW Occupancy Group: Reference#: 94-957 Status: ISSUED Description: 235 SF ADDIT-FAM ROOM-1ST FLOR Applied: 04/27/95 Apr/Issue: 11/02/95 Entered By: RMA Appl/Ownr : ROYCE, ROBERT 619 434-6259 CARLSBAD, CA. 92008 2956 ROOSEVELT #3 *x* Fees Required *** lected & Credits *** "~"""""~""""" Fees : ""~"""""""""~ Adjustments: .oo Total Fees: 109.00 .oo Fee description Ext fee Data """"""""" Plan Check Revisi """ _"""_""""" 109.00 CITY OF CARLSBAD 2075 Las palmas Dr., Carlsbad, CA 92009 (619) 438-1161 1. Prom Iist 1 (see back) giw de of Fwmit-Type: P-A a For Residential Pmiects Only: From list 2 (see back) giw ____________________.."..."."~..~.".."""~...".". ZIP CODE -0 with eantractor(s) licensed purauant to the Contractor's license law). 0 I am exempt under Section Is registration form or risk management and bunt Act? feet of the outer boundary of a school site? LENDER'S NAME provisions of this code shall in 365 days from the date of PERMIT APPLIcATlON 2075 La8 Palms Dr., Carlobed, u %?OW (619) 438-1161 City of Carlobed hitdim Departmt From list 1 (see back) give code of Permit-%: ................................................... For Residential Pmiects Only: From kt 2 [see back) give Code of Structure-Type: Net WGain of Dwelling Units 2 PRCIIEIXINFORMAnON FOR OFFICE USE ONLY NAMMname ADDeSS CITY DAY TELEPHONE STATE LIC. # " LICENSE CLASS CITY BUSINESS LIC. # STATE ZIP CODE 7- DAY TEmFHONE~~~ " CITY AT€LIC.# E I Workers' Chmpensatton Oeclaratlon: 1 hereby altlrm that 1 have a certltlcate ot consent to selt-msure lssued by the Director ot lndusrnal Relations. or a certificate of Workers' Compensation Insurance by an admitted insurer, or an exact copy or duplicate thereof certified by the Director of the insurer thereof filed with the Building Inspection Department (Section 3800, lab. C). INSURANCE COMPANY POLICY NO. CeNtlcate 01 Exempuon: I certlty that I" the pertarmanee ot the work tor whlch thls permlt u ~ssued, 1 Shall not employ any person In any manner so as to become subject to the Workers' Compensation laws of California. EXPIRATION DATE SIGNATURE by attlrm that I am exempt tmm the wnmactors ucense law tor the tollow~n~ reason: - I, as owner of the property or my employees with wages as their sole compensation, will do the work and the ~tru~~re is not intended or offered for sale (Sec. 7044, Business and Professions Code: The Contractor's License law dm not apply to an owner of property who builds or improves thereon, and who does such work himself or through his own employees, provided that such improvements are not intended or offered for sale. If, however, the building or improvement is sold within one year of completion, the owner-builder will have the burden of proving that he did not build or improve for the purpose of sale.). I, as owner ofthe property, am exclusively contracting with licensed contractors to construct the project (Sec. 7044, Business and Professions Code: The Contractor's License law dm not apply to an owner of property who builds or improves thereon, and contracts for such projects with contractor(s) licensed punuant to the Contractor's license law). I am exempt under Section Business and Professions Code for this reason: (Sec. 7031.5 Business and Professions Code: Any City or County which requires a permit to construct, alter, improve, demolish, or repair any structure, prior to its issuance, also requires the applicanr for such permit to file a signed statement that he is licensed punuant to the provisions of the Cantractor's License law (Chapter 9, commencing with Section 7000 of Division 3 of the Business and Professions Code) or that he is exempt therefrom. and the basis for the alleged exemption. Any violation of Section 7031.5 by any applicant for a permit subjects the applicant to a civil penalty of not more than five hundred dollars [$5001). SIGNATURE DATE Is the applicant or future building occupant required to submit a business plan, acutely hazardous materials registration form or risk management and prevention program under Sections 25505, 25533 or 25534 of the Prerley-Tanner Hazardous Substance Account Act? Is the applicant or future building occupant required to obtain a permit from the air pollution control disuict or air quality management district? Is the facility to be constructed within 1,000 feet of the outer boundary of a rhml site? nANYOFTHEAN~AREYE$AFINAl~~CAIEOFOOCLlPANOIMAYNOTBE~APIWnnY1,1989~THEAPPIICANT HAS MET OR 1s -G lHE RF.QWRWlWl5 OF lHE OFFICI! OF EMERGmCY SERWCIS AND THE AIR HllLunoN CONTROL DlSlTUIX. I hereby attlrm that there IS a mnstmctlon lendlng agency tor the pertormance 01 the work tor whleh thu permlt IS lssued [Set 3097(1] Clnl We). 0 YES 0 NO 0 YES 0 NO DYES 0 NO LENDERS NAME LENDER'S ADDRESS I certlty that 1 have read the appllcauon and State that the move lntormauon IS correct. 1 agree to comply wlth all Llty oralnances and state laws purposes. IAISOACREETOSAVEINDEMNIPYANDKEEPHARMIPSSTHE~OFCARlSBADACAINmAU.~~JUOG~ODSTS relating to building construction. I hereby authorize repmntatives of the City of Carkbad to enter upon the above mentioned property for inspection AND MPENSES WHICH MAY IN ANY WAY ArmuE AGAINST SAID CIlY IN CONseQuwce OF lHE GRANTlNG OF TIIS PERMIT. OSHA: An OSHA permit is required for excavations over 5'0" deep and demolition or construction of structures over 3 stories in height Expiration. Every permit issued by the Building Official under the provisions of this Code shall expire by limitation and become null and void if the building or work authorized by such permit is not commenced within 365 days from the date of such permit or if the building or work authorized by doned at any time after the work is commenced for a period of 180 days (Section 303(d) Uni i3 APPROVAVRESO. NO. DATE: PROJECT NO. OTHER RELATED CAS=. Compliance with condidoar of approval? ff not, stare conditiotu which require action, Conditions d rrppronl - /' * Diego Cwt District, 31 11 clmino Del Rio Nod, Suite 200, Sm Diego, CA. 92108-1 725 (619) 5219036 360 2. Provide legal description of prom, and asscu~r's parcel number. %O ZO* 1. Sctbadcr: Front: Int. Side: Street Side: Rcu: A PLANNING/ENGINEERING APPROVALS TENANT IMPROVEMENT /"- \ RESIDENTIAL ADDITION MINOR PLAZA CAMINO REAL ~<510,oO0.00) '' \~ .. VILLAGE FAIRE COMPLETE OFFICE BUILDING PLANNER DATE 1 C:\WPSl\FILES\BLDG.FRM Rev 1 1 I1 5/90 Compliance Method - MICROPAS June 19, 1995 PARKER ADDITION La Costa Climate Zone 7 Robert Royce, AIA Haynal and Company, Inc. & Tustin (714) 573-4065 Escondido (619) 743-5408 San Diego (619) 531 -1 122 Contractor's License #649028 REQUIREMENTS SUMMARY: TITLE 24 COMPLIANCE Each of the following specificitem, the MF-lRpage, and the signed CF- IRpages must be clearlylisted on thephns. H&\ng:Ef- Setback required Thermostat . . R-2.1 (existing) R-4.2 (new) Duct tnsufintion 78% AFUE minimum .. Coolifig.:Effi&ncy' '..: 10.0 SEER minimum EQUIPMENT RECOMMENDATIONS (or equal) H.P. Make & Model : Rheek RQKA-024JA Package Heat Pump Output Capacity : 23,000 Btuh Heating / 22,600 Btuh Cooling Master Bedroom H.P. Make &Model : PKH-24EK Output Capacity : 25,000 Btuh Heating / 24,000 Btuh Cooling at three feet above the floor throughout the conditionedspace of the residence. The recommendation Note: The UBC requires that the heating system be capable of maintaining a temperature of 70 degrees above is based on MICROPAS heating and/or cooling load calculations. THE CONTRACTOR IS RESPONSIBLE FOR THE F'INAL SIZING OF HEATING AND COOLING EQUIPMENT. ROBERT J. ROYCE ALA. ARCHlTECTURE/PLANNINQ/INTERIORB April 24,1995 CITY OF CARLSBAD BUILDING DEPARTMENT CITY OF CARLSBAD ESGIL PLAN CHECKING AGENCY RE Plan I.D.# 94-957 Dear Building Department official: Enclosed please find revised Copies of building plans and structural calculations. The original plans for a small Master Bedroom closet addition have been revised based on exploratory field surveys of the existing conditions and a request from the owner to include a small addition to the family room area, approximately 235 S.F. The original structural calculations are enclosed (Job # 9420). Since providing these Calcs and receiving approval for construction we have identified a 4x6 structural post in the existing garage which will be able to carry most of the loads we have designed for. (See revised plans and structural Calcs #9504 enclosed). This has simplified the structural design for that portion of the building. In addition to this construction we are also proposing a one story addition to the existing Family Room. (See new sheets 5 & 6 now enclosed and structural Calcs #9505 enclosed). I hope this helps in your understanding and expeditious processing of the project. Please do not hesitate to call me with any questions or for additional clarification required. Sincerely, ,."-l 2956 Roosevelt Street, Suite 3 - Carlsbad, CA 92008 , i I .. i' I 3 I. . I -, .. i .. I 2 "