Loading...
HomeMy WebLinkAboutCD 2022-0027; ACTIVE MOTIF; ACTIVE MOTIF TRASH CAPTURE STORM WATER QUALITY MANAGEMENT PLAN; 2022-11-10CITY OF CARLSBAD TRASH CAPTURE STORM WATER QUALITY MANAGEMENT PLAN (SWQMP) FOR [INSERT PROJECT NAME] [INSERT PROJECT ID (CT/MS/SDP/CDP/PD)] [INSERT DRAWING No. (DWG ___-__)] [INSERT GR No. _________] ENGINEER OF WORK: [INSERT CIVIL ENGINEER'S NAME AND PE NUMBER HERE, PROVIDE WET SIGNATURE AND STAMP ABOVE LINE] PREPARED FOR: [INSERT APPLICANT NAME] [INSERT ADDRESS] [INSERT CITY, STATE ZIP CODE] [INSERT TELEPHONE NUMBER] PREPARED BY: [INSERT COMPANY NAME] [INSERT ADDRESS] [INSERT CITY, STATE ZIP CODE] [INSERT TELEPHONE NUMBER] DATE: [INSERT MONTH, DAY, YEAR] Samuel Michael Bellomio, RCE 90818 November 10, 2022 Ware Malcomb 3911 Sorrento Valley Blvd. Ste 120 San Diego, CA 92121 Project Name: Active Motif Generator Project ID: CD2022-0027 Permit No.: EAGREE2022-0034/CBC2022-0161 Active Motif 1914 Palomar Oaks Way, Suite 150 Carlsbad, CA 92008 1/31/23 RECORD COPY ~I Date TABLE OF CONTENTS Certification Page Project Vicinity Map FORM E-34 Storm Water Standard Questionnaire Site Information FORM E-36 Standard Project Requirement Checklist Summary of Trash Capture Structural BMPs Attachment 1: Backup for Trash Capture BMPs Attachment 1a: DMA Exhibit Attachment 1b: Tabular Summary of DMAs Attachment 1c: Trash Capture BMP Design Calculations Attachment 2: Trash Capture BMP Maintenance Thresholds and Actions Attachment 3: Single Sheet BMP (SSBMP) Exhibit CERTIFICATION PAGE Project Name: Project ID: I hereby declare that I am the Engineer in Responsible Charge of design of storm water BMPs for this project,and that I have exercised responsible charge over the design of the project as defined in Section 6703 of the Business and Professions Code, and that the design is consistent with the requirements of the BMP Design Manual, which is based on the requirements of SDRWQCB Order No. R9-2013-0001 (MS4 Permit)or the current Order. I have read and understand that the City Engineer has adopted minimum requirements for managing urban runoff, including storm water, from land development activities, as described in the BMP Design Manual. I certify that this SWQMP has been completed to the best of my ability and accurately reflects the project being proposed and the applicable source control and site design BMPs proposed to minimize the potentially negative impacts of this project's land development activities on water quality.I understand and acknowledge that the plan check review of this SWQMP by the City Engineer is confined to a review and does not relieve me, as the Engineer in Responsible Charge of design of storm water BMPs for this project, of my responsibilities for project design. ________________________________________________________ Engineer of Work's Signature, PE Number & Expiration Date ________________________________________________________ Print Name ________________________________________________________ Company ____________________________ Date Samuel Michael Bellomio Ware Malcomb 90818 12/31/2023 11/10/2022 Active Motif Generator CD2022-0027 PROJECT VICINITY MAP PROJECT SITE N EB NOT TO SCALE STORM WATER STANDARDS QUESTIONNAIRE E-34 Development Services Land Development Engineering 1635FaradayAvenue 442-339-2750 www.carlsbadca.gov To address post-development pollutants that may be generated from development projects, the city requires that new development and significant redevelopment priority projects incorporate Permanent Storm Water Best Management Practices (BMPs) into the project design per Carlsbad BMP Design Manual (BMP Manual). To view the BMP Manual, refer to the Engineering Standards (Volume 5). This questionnaire must be completed by the applicant in advance of submitting for a development application (subdivision, discretionary permits and/or construction permits). The results of the questionnaire determine the level of storm water standards that must be applied to a proposed development or redevelopment project. Depending on the outcome, your project will either be subject to ‘STANDARD PROJECT’ requirements, “PRIORITY DEVELOPMENT PROJECT (PDP) requirements or not considered a development project. This questionnaire will also determine if the project is subject to TRASH CAPTURE REQUIREMENTS. Your responses to the questionnaire represent an initial assessment of the proposed project conditions and impacts. City staff has responsibility for making the final assessment after submission of the development application. If staff determines that the questionnaire was incorrectly filled out and is subject to more stringent storm water standards than initially assessed by you, this will result in the return of the development application as incomplete. In this case, please make the changes to the questionnaire and resubmit to the city. If you are unsure about the meaning of a question or need help in determining how to respond to one or more of the questions, please seek assistance from Land Development Engineering staff. A completed and signed questionnaire must be submitted with each development project application. Only one completed and signed questionnaire is required when multiple development applications for the same project are submitted concurrently. PROJECT INFORMATION PROJECT NAME:APN: ADDRESS: The project is (check one): New Development Redevelopment The total proposed disturbed area is:ft2 ( ) acres The total proposed newly created and/or replaced impervious area is:ft2 ( ) acres If your project is covered by an approved SWQMP as part of a larger development project, provide the project ID and the SWQMP # of the larger development project: Project ID SWQMP #: Then, go to Step 1 and follow the instructions. When completed, sign the form at the end and submit this with your application to the city. This Box for City Use Only City Concurrence: YES NO Date: Project ID: By: E-34 Page 1 of 4 REV 08/22 INSTRUCTIONS: Active Motif Generator 1914 Palomar Oaks Way, Carlsbad, CA 92008 212-092-35-00 1,316 0.03 1,316 0.03 CD2022-0027 C cityof Carlsbad □ ~ E-34 Page 2 of 4 REV 08/22 STEP 1 TO BE COMPLETED FOR ALL PROJECTS To determine if your project is a “development project”, please answer the following question: YES NO Is your project LIMITED TO routine maintenance activity and/or repair/improvements to an existing building or structure that do not alter the size (See Section 1.3 of the BMP Design Manual for guidance)? If you answered “yes” to the above question, provide justification below then go to Step 6, mark the box stating “my project is not a ‘development project’ and not subject to the requirements of the BMP manual” and complete applicant information. Justification/discussion: (e.g. the project includes only interior remodels within an existing building): If you answered “no” to the above question, the project is a ‘development project’, go to Step 2. STEP 2 TO BE COMPLETED FOR ALL DEVELOPMENT PROJECTS To determine if your project is exempt from PDP requirements pursuant to MS4 Permit Provision E.3.b.(3), please answer the following questions: Is your project LIMITED to one or more of the following: YES NO 1. Constructing new or retrofitting paved sidewalks, bicycle lanes or trails that meet the following criteria: a) Designed and constructed to direct storm water runoff to adjacent vegetated areas, or other non- erodible permeable areas; OR b) Designed and constructed to be hydraulically disconnected from paved streets or roads; OR c) Designed and constructed with permeable pavements or surfaces in accordance with USEPA Green Streets guidance? 2. Retrofitting or redeveloping existing paved alleys, streets, or roads that are designed and constructed in accordance with the USEPA Green Streets guidance? 3. Ground Mounted Solar Array that meets the criteria provided in section 1.4.2 of the BMP manual? If you answered “yes” to one or more of the above questions, provide discussion/justification below, then go to Step 6, mark the second box stating “my project is EXEMPT from PDP …” and complete applicant information. Discussion to justify exemption (e.g. the project redeveloping existing road designed and constructed in accordance with the USEPA Green Street guidance): If you answered “no” to the above questions, your project is not exempt from PDP, go to Step 3. □ IZ( □ IZ( □ IZ( □ ~ E-34 Page 3 of 4 REV 08/22 STEP 3 TO BE COMPLETED FOR ALL NEW OR REDEVELOPMENT PROJECTS To determine if your project is a PDP, please answer the following questions (MS4 Permit Provision E.3.b.(1)): YES NO 1. Is your project a new development that creates 10,000 square feet or more of impervious surfaces collectively over the entire project site? This includes commercial, industrial, residential, mixed-use, and public development projects on public or private land. 2. Is your project a redevelopment project creating and/or replacing 5,000 square feet or more of impervious surface collectively over the entire project site on an existing site of 10,000 square feet or more of impervious surface? This includes commercial, industrial, residential, mixed-use, and public development projects on public or private land. 3. Is your project a new or redevelopment project that creates and/or replaces 5,000 square feet or more of impervious surface collectively over the entire project site and supports a restaurant? A restaurant is a facility that sells prepared foods and drinks for consumption, including stationary lunch counters and refreshment stands selling prepared foods and drinks for immediate consumption (Standard Industrial Classification (SIC) code 5812). 4. Is your project a new or redevelopment project that creates 5,000 square feet or more of impervious surface collectively over the entire project site and supports a hillside development project? A hillside development project includes development on any natural slope that is twenty-five percent or greater. 5. Is your project a new or redevelopment project that creates and/or replaces 5,000 square feet or more of impervious surface collectively over the entire project site and supports a parking lot? A parking lot is a land area or facility for the temporary parking or storage of motor vehicles used personally for business or for commerce. 6. Is your project a new or redevelopment project that creates and/or replaces 5,000 square feet or more of impervious street, road, highway, freeway or driveway surface collectively over the entire project site? A street, road, highway, freeway or driveway is any paved impervious surface used for the transportation of automobiles, trucks, motorcycles, and other vehicles. 7. Is your project a new or redevelopment project that creates and/or replaces 2,500 square feet or more of impervious surface collectively over the entire site, and discharges directly to an Environmentally Sensitive Area (ESA)? “Discharging Directly to” includes flow that is conveyed overland a distance of 200 feet or less from the project to the ESA, or conveyed in a pipe or open channel any distance as an isolated flow from the project to the ESA (i.e. not commingled with flows from adjacent lands).* 8. Is your project a new development or redevelopment project that creates and/or replaces 5,000 square feet or more of impervious surface that supports an automotive repair shop? An automotive repair shop is a facility that is categorized in any one of the following Standard Industrial Classification (SIC) codes: 5013, 5014, 5541, 7532-7534, or 7536-7539. 9. Is your project a new development or redevelopment project that creates and/or replaces 5,000 square feet or more of impervious area that supports a retail gasoline outlet (RGO)? This category includes RGO’s that meet the following criteria: (a) 5,000 square feet or more or (b) a project Average Daily Traffic (ADT) of 100 or more vehicles per day. 10. Is your project a new or redevelopment project that results in the disturbance of one or more acres of land and are expected to generate pollutants post construction? 11. Is your project located within 200 feet of the Pacific Ocean and (1) creates 2,500 square feet or more of impervious surface or (2) increases impervious surface on the property by more than 10%? (CMC 21.203.040) If you answered “yes” to one or more of the above questions, your project is a PDP. If your project is a redevelopment project, go to step 4. If your project is a new project, go to step 5, complete the trash capture question. If you answered “no” to all of the above questions, your project is a ‘STANDARD PROJECT’. Go to step 5, complete the trash capture question. * Environmentally Sensitive Areas include but are not limited to all Clean Water Act Section 303(d) impaired water bodies; areas designated as Areas of Special Biological Significance by the State Water Resources Control Board (Water Quality Control Plan for the San Diego Basin (1994) and amendments); water bodies designated with the RARE beneficial use by the State Water Resources Control Board (Water Quality Control Plan for the San Diego Basin (1994) and amendments); areas designated as preserves or their equivalent under the Multi Species Conservation Program within the Cities and County of San Diego; Habitat Management Plan; and any other equivalent environmentally sensitive areas which have been identified by the City. □ IZl: □ ~ □ M □ ~ □ ~ □ ~ □ ~ □ ~ □ ~ □ ~ □ ~ E-34 Page 4 of 4 REV 08/22 STEP 4 TO BE COMPLETED FOR REDEVELOPMENT PROJECTS THAT ARE PRIORITY DEVELOPMENT PROJECTS (PDP) ONLY Complete the questions below regarding your redevelopment project (MS4 Permit Provision E.3.b.(2)): YES NO Does the redevelopment project result in the creation or replacement of impervious surface in an amount of less than 50% of the surface area of the previously existing development? Complete the percent impervious calculation below: Existing impervious area (A) = sq. ft. Total proposed newly created or replaced impervious area (B) = sq. ft. Percent impervious area created or replaced (B/A)*100 = % If you answered “yes”, the structural BMPs required for PDP apply only to the creation or replacement of impervious surface and not the entire development. Go to step 5, complete the trash capture question. If you answered “no,” the structural BMP’s required for PDP apply to the entire development. Go to step 5, complete the trash capture question. STEP 5 TO BE COMPLETED FOR ALL DEVELOPMENT PROJECTS Complete the question below regarding your Project (SDRWQCB Order No. 2017-0077): YES NO Is the Project within any of the following Priority Land Use (PLU) categories and not exempt from trash capture requirements per section 4.4.2.2 of the BMP Manual? R-23 (15-23 du/ac), R-30 (23-30 du/ac), PI (Planned Industrial), CF (Community Facilities), GC (General Commercial), L (Local Shopping Center), R (Regional Commercial), V-B (Village-Barrio), VC (Visitor Commercial), O (Office), VC/OS (Visitor Commercial/Open Space), PI/O (Planned Industrial/Office), or Public Transportation Station If you answered “yes”, the ‘PROJECT’ is subject to TRASH CAPTURE REQUIREMENTS. Go to step 6, check the first box stating, “My project is subject to TRASH CAPTURE REQUIREMENTS …” and the second or third box as determined in step 3. If you answered “no”, Go to step 6, check the second or third box as determined in step 3. List exemption if applicable for ‘no’ answer here: STEP 6 CHECK THE APPROPRIATE BOX(ES) AND COMPLETE APPLICANT INFORMATION My project is subject to TRASH CAPTURE REQUIREMENTS and must comply with TRASH CAPTURE REQUIREMENTS of the BMP Manual. I understand I must prepare a Storm Water Quality Management Plan (SWQMP). My project is a ‘STANDARD PROJECT’ OR EXEMPT from PDP and must only comply with ‘STANDARD PROJECT’ stormwater requirements of the BMP Manual. I will submit a “Standard Project Requirement Checklist Form E-36”. If my project is subject to TRASH CAPTURE REQUIREMENTS, I will submit a TRASH CAPTURE Storm Water Quality Management Plan (TCSWQMP) per E-35A. My project is a PDP and must comply with PDP stormwater requirements of the BMP Manual. I understand I must prepare a Storm Water Quality Management Plan (SWQMP) per E-35 template for submittal at time of application. Note: For projects that are close to meeting the PDP threshold, staff may require detailed impervious area calculations and exhibits to verify if ‘STANDARD PROJECT’ stormwater requirements apply. My project is NOT a ‘development project’ and is not subject to the requirements of the BMP Manual. Applicant Information and Signature Box Applicant Name: Applicant Title: Applicant Signature: Date: Samuel Bellomio Civil Engineering Manager 11/10/2022 □ □ ~ □ ~ M □ □ ✓ ~ SITE INFORMATION CHECKLIST Project Summary Information Project Name Project ID Project Address Assessor's Parcel Number(s) (APN(s)) Project Watershed (Hydrologic Unit) Carlsbad 904 Parcel Area ________ Acres (____________ Square Feet) Active Motif Generator 212-092-35-00 2.49 108,418 1914 Palomar Oaks Way, Carlsbad, CA 92008 .40 CD2022-0027 Description of Existing Site Condition and Drainage Patterns Select applicable Land Use Category: High Density Residential R-23 (15-23 du/ac) R-30 (23-30 du/ac) Industrial PI (Planned Industrial) Commercial CF (Community Facilities) GC (General Commercial) L (Local Shopping Center) R (Regional Commercial) V-B (Village-Barrio) VC (Visitor Commercial) O (Office) VC/OS (Visitor Commercial/Open Space) Mixed Urban PI/O (Planned Industrial/Office) Public Transportation Stations Description / Additional Information: Description of Existing Site Topography and Drainage [How is storm water runoff conveyed from the site? At a minimum, this description should answer (1) whether existing drainage conveyance is natural or urban; (2) describe existing constructed storm water conveyance systems, if applicable; and (3) is runoff from offsite conveyed through the site? if so, describe]: The project site drainage conveyance is urban. Stormwater runoff generally sheet flows east to west towards Palomar Oaks Way. A network of curbs, gutters and storm pipes direct runoff towards the existing storm drain network located along Palomar Oaks Way. Offsite runoff is conveyed through the site. X X Description of Proposed Site Development and Drainage Patterns Project Description / Proposed Land Use and/or Activities: Does the project include grading and changes to site topography? Yes No Description / Additional Information: Does the project include changes to site drainage (e.g., installation of new storm water conveyance systems)? Yes No Description / Additional Information: Optional Additional Information or Continuation of Previous Sections As Needed This space provided for additional information or continuation of information from previous sections as needed. The site is already developed. The proposed work will not alter existing drainage patterns. The site renovation work includes grading for a new generator pad enclosure. The existing site is a developed property including: a commercial building, parking lot, sidewalk and landscape areas. X X E-36 Page 1 of 4 Revised 02/22 Development Services Land Development Engineering 1635 Faraday Avenue 442-339-2750 www.carlsbadca.gov STANDARD PROJECT REQUIREMENT CHECKLIST E-36 Project Information Project Name: Project ID: DWG No. or Building Permit No.: Baseline BMPs for Existing and Proposed Site Features Complete the Table 1 - Site Design Requirement to document existing and proposed site features and the BMPs to be implemented for them. All BMPs must be implemented where applicable and feasible. Applicability is generally assumed if a feature exists or is proposed. BMPs must be implemented for site design features where feasible. Leaving the box for a BMP unchecked means it will not be implemented (either partially or fully) either because it is inapplicable or infeasible. Explanations must be provided in the area below. The table provides specific instructions on when explanations are required. Table 1 - Site Design Requirement A.Existing Natural Site Features (see Fact Sheet BL-1) 1. Check the boxes below for each existing feature on the site. 1.Select the BMPs to be implemented for each identified feature. Explain why any BMP not selected is infeasible in the area below. SD-G Conserve natural features SD-H Provide buffers around waterbodies Natural waterbodies Natural storage reservoirs & drainage corridors -- Natural areas, soils, & vegetation (incl. trees)-- B.BMPs for Common Impervious Outdoor Site Features (see Fact Sheet BL-2) 1. Check the boxes below for each proposed feature. 2. Select the BMPs to be implemented for each proposed feature. If neither BMP SD-B nor SD-I is selected for a feature, explain why both BMPs are infeasible in the area below. SD-B Direct runoff to pervious areas SD-I Construct surfaces from permeable materials Minimize size of impervious areas Streets and roads Check this box to confirm that all impervious areas on the site will be minimized where feasible. If this box is not checked, identify the surfaces that cannot be minimized in area below, and explain why it is Sidewalks & walkways Parking areas & lots Driveways Patios, decks, & courtyards Hardcourt recreation areas Active Motif Generator CD2022-0027 EAGREE2022-0034; CBC2022-0161 □ □ !&I □ □ □ !&I □ □ C cityof Carlsbad □ □ □ !&I □ □ □ □ □ !&I □ !&I □ □ □ □ □ E-36 Page 2 of 4 Revised 02/22 Other: _______________ infeasible to do so. C. BMPs for Rooftop Areas: Check this box if rooftop areas are proposed and select at least one BMP below. If no BMPs are selected, explain why they are infeasible in the area below. (see Fact Sheet BL-3) SD-B Direct runoff to pervious areas SD-C Install green roofs SD-E Install rain barrels D. BMPs for Landscaped Areas: Check this box if landscaping is proposed and select the BMP below SD-K Sustainable Landscaping If SD-K is not selected, explain why it is infeasible in the area below. (see Fact Sheet BL-4) Provide discussion/justification for site design BMPs that will not be implemented (either partially or fully): Baseline BMPs for Pollutant-generating Sources All development projects must complete Table 2 - Source Control Requirement to identify applicable requirements for documenting pollutant-generating sources/ features and source control BMPs. BMPs must be implemented for source control features where feasible. Leaving the box for a BMP unchecked means it will not be implemented (either partially or fully) either because it is inapplicable or infeasible. Explanations must be provided in the area below. The table provides specific instructions on when explanations are required. Table 2 - Source Control Requirement A. Management of Storm Water Discharges 1. Identify all proposed outdoor work areas below Check here if none are proposed 2. Which BMPs will be used to prevent materials from contacting rainfall or runoff? (See Fact Sheet BL-5) Select all feasible BMPs for each work area 3. Where will runoff from the work area be routed? (See Fact Sheet BL-6) Select one or more option for each work area SC-A Overhead covering SC-B Separation flows from adjacent areas SC-C Wind protection SC-D Sanitary sewer SC-E Containment system Other Trash & Refuse Storage Materials & Equipment Storage The project only proposes a new generator pad and enclosure. The project only proposes a new generator pad and enclosure. □ □ □ D □ □ □ D D 181 □ □ □ □ □ □ □ □ □ □ □ □ □ □ E-36 Page 3 of 4 Revised 02/22 Loading & Unloading Fueling Maintenance & Repair Vehicle & Equipment Cleaning Other: _________________ B. Management of Storm Water Discharges (see Fact Sheet BL-7) Select one option for each feature below: x Storm drain inlets and catch basins … are not proposed will be labeled with stenciling or signage to discourage dumping (SC-F) x Interior work surfaces, floor drains & sumps … are not proposed will not discharge directly or indirectly to the MS4 or receiving waters x Drain lines (e.g. air conditioning, boiler, etc.) … are not proposed will not discharge directly or indirectly to the MS4 or receiving waters x Fire sprinkler test water … are not proposed will not discharge directly or indirectly to the MS4 or receiving waters Provide discussion/justification for source control BMPs that will not be implemented (either partially or fully): □ □ □ □ □ □ □ □ □ □ □ □ □ □ □ □ □ □ □ □ □ □ □ □ □ □ □ □ □ □ □ □ □ □ □ !&I □ !&I □ !&I □ !&I □ E-36 Page 4 of 4 Revised 02/22 Form Certification This E-36 Form is intended to comply with applicable requirements of the city’s BMP Design Manual. I certify that it has been completed to the best of my ability and accurately reflects the project being proposed and the applicable BMPs proposed to minimize the potentially negative impacts of this project's land development activities on water quality. I understand and acknowledge that the review of this form by City staff is confined to a review and does not relieve me as the person in charge of overseeing the selection and design of storm water BMPs for this project, of my responsibilities for project design. Preparer Signature: Date: Print preparer name: Samuel Bellomio 11/10/2022 ,,,,,,,, -,~ I -( SUMMARY OF TRASH CAPTURE BMPS Trash Capture BMPs All projects subject to trash capture requirements must implement trash capture BMPs (see Chapter 4 of the BMP Design Manual). Selection of trash capture BMPs must be based on the selection process described in Chapter 4. Trash capture BMPs must be verified by the City at the completion of construction. This may include requiring the project owner or project owner's representative to certify construction of the trash capture BMPs (see Section 1.12 of the BMP Design Manual). Trash capture BMPs must be maintained into perpetuity, and the City must confirm the maintenance (see Section 7 of the BMP Design Manual). Use this form to provide narrative description of the general strategy for trash capture BMP implementation at the project site in the box below. Then complete the trash capture BMP summary information sheet for each trash capture BMP within the project (copy the BMP summary information page as many times as needed to provide summary information for each trash capture BMP). Describe the general strategy for trash capture BMP implementation at the site. This information must describe how the steps for selecting and designing trash capture BMPs presented in Section 4.4 of the BMP Design Manual were followed, and the results (type of BMPs selected). [Continue on next page as necessary.] The proposed improvements will not add additional storm drain inlets. The project will propose to retrofit the existing grated inlet structures located throughout the property with Bioclean Grate Inlet Filters (selected from the "Certified Capture System List of Trash Treatment Control Devices Updated September 2021"). The trash capture BMPs were sized by calculating the site-specific one-year, one-hour flow rate and comparing it to the trash capture device treatment flow rate (See Attachment 1c for calculations). The selected trash capture BMP was selected to meet the requirements set forth in the City of Carlsbad BMP Design Manual revised September 1, 2021. [Continued from previous page – This page is reserved for continuation of description of general strategy for trash capture BMP implementation at the site.] Trash Capture BMP Summary Information BMP ID No. Type of Trash Capture BMP Permit No. Drawing No. Bioclean Grate Inlet FilterBMP-1 Bioclean Grate Inlet FilterBMP-2 Bioclean Grate Inlet FilterBMP-3 CBC2022-0161 BMP-4 Bioclean Grate Inlet Filter CBC2022-0161 CBC2022-0161 CBC2022-0161 EAGREE2022-0034 EAGREE2022-0034 EAGREE2022-0034 EAGREE2022-0034 ATTACHMENT 1 BACKUP FOR TRASH CAPTURE BMPS This is the cover sheet for Attachment 1. Check which Items are Included behind this cover sheet: Attachment Sequence Contents Checklist Attachment 1a DMA Exhibit (Required) See DMA Exhibit Checklist on the back of this Attachment cover sheet. (24”x36” Exhibit typically required) Included Attachment 1b Tabular Summary of DMAs Showing DMA ID matching DMA Exhibit, DMA Area, and DMA Type (Required)* *Provide table in this Attachment OR on DMA Exhibit in Attachment 1a Included on DMA Exhibit in Attachment 1a Included as Attachment 1b, separate from DMA Exhibit Attachment 1c Trash Capture BMP Design Worksheets / Calculations (Required) Refer to Appendices J of the BMP Design Manual for trash capture BMP design guidelines Included X X X Use this checklist to ensure the required information has been included on the DMA Exhibit: The DMA Exhibit must identify: Site topography and impervious areas Site drainage network and connections to drainage offsite Proposed grading (if applicable) Drainage management area (DMA) boundaries, DMA ID numbers, and DMA areas (square footage or acreage) Trash Capture BMPs (identify location and type of BMP) Attachment 1a X X X X X N79°41'14"E 3 7 0 . 0 8 ' N57°4 7 ' 4 8 " E 1 6 8 . 0 0 ' N0 2 ° 3 7 ' 0 1 " W 2 4 0 . 1 3 ' N83°48'29"E 274.72' N0 4 ° 5 9 ' 1 7 " W 15 . 3 4 ' N83°49'29"E 41.50' N59°3 7 ' 1 4 " E 1 0 2 . 0 6 ' N 3 2 ° 1 2 ' 1 2 " W 1 9 5 . 0 8 ' Δ = 0 1 ° 4 9 ' 2 6 " R = 7 3 6 . 0 0 ' L = 2 3 . 4 3 ' C L DMA-2 0.72 AC. C: 0.79 DMA-1 0.22 AC. C: 0.73 DMA-3 0.93 AC. C: 0.87 BMP-1 BIOCLEAN GRATE INLET FILTER BIO-GRATE-FULL 24-24-24 BMP-2 BIOCLEAN GRATE INLET FILTER BIO-GRATE-FULL 24-24-24 BMP-3 BIOCLEAN GRATE INLET FILTER BIO-GRATE-FULL 24-24-24 PROPOSED GENERATOR AND GENERATOR ENCLOSURE EXISTING COMMERC I A L BUILDING DMA-4 0.05 AC. C: 0.90 BMP-4 BIOCLEAN GRATE INLET FILTER BIO-GRATE-FULL 18-18-12 0 15 30 60 KEY IMPERVIOUS AREA BUILDING IMPERVIOUS AREA SURFACE FLOW PATH PERVIOUS AREA PROPERTY LINE DMA BOUNDARY WARE MALCOMB assumes no responsibility for utility locations. The utilities shown on this drawing have been plotted from the best available information. It is, however, the contractors responsibility to field verify the location of all utilities prior to the commencement of any construction. SOURCE CONTROL SOURCE CONTROL REQUIREMENT APPLIED IMPLEMENTATION SC-1 PREVENTION OF ILLICIT DISCHARGES YES USE OF EFFECTIVE IRRIGATION INCLUDES IN THE DESIGN AND UTILIZATION OF EXISTING RUNOFF COLLECTION POND FOR MONITORING RUNOFF AND REUSE SC-2 STORM DRAIN STENCILING OR SIGNAGE YES STENCIL EVERY INLET WITH PROHIBITIVE LANGUAGE "NO DUMPING! LEADS TO WATERWAYS" AND "NO CONTAMINE" IN SPANISH DMA EXHIBIT: SOIL GROUPS: THE SITE IS UNDERLAIN BY SOIL GROUP "B & D". NO EXISTING NATURAL HYDROLOGIC FEATURES NO CRITICAL COURSE SEDIMENT AREAS TO BE PROTECTED DEPTH TO GROUNDWATER EXPECTED TO BE OVER 20FT* FEATURES TO MINIMIZE IMPERVIOUSNESS: PAVEMENT WIDTHS ARE KEPT TO MINIMUM DESIGN STANDARDS SOURCE CONTROL SOURCE CONTROL REQUIREMENT APPLIED IMPLEMENTATION SD-3 MINIMIZE IMPERVIOUS AREA YES PAVEMENT WIDTHS ARE KEPT TO MINIMUM DESIGN STANDARDS. DMA TOTAL AREA (SF) AREA (AC) PERVIOUS AREA (SF) IMPERVIOUS AREA (SF) % IMPERVIOUS C Q1yr-1hr (CFS)BMP TYPE MODEL NO. TRASH CAPTURE TREATMENT FLOW RATE (CFS) 1 9,486 0.22 2,072 7,414 78%0.73 0.07 Grate Inlet Filter BIO-GRATE-FULL 24-24-24 7.31 2 31,458 0.72 4,366 27,092 86%0.79 0.24 Grate Inlet Filter BIO-GRATE-FULL 24-24-24 7.31 3 40,314 0.93 1,664 38,650 96%0.87 0.33 Grate Inlet Filter BIO-GRATE-FULL 24-24-24 7.31 4 2,043 0.05 0 2,043 100%0.90 0.02 Grate Inlet Filter BIO-GRATE-FULL 18-18-12 1.78 BMP TYPEBMP ID #SYMBOL CASQA NO.DRAWING NO.SHEET NO.(S)MAINTENANCE FREQUENCY BMP TABLE INSPECTION FREQUENCYQUANTITY HYDROMODIFICATION & TREATMENT CONTROL 4 EA ** AS-NEEDED1GRATE INLET FILTER AS-NEEDED PARTY RESPONSIBLE FOR MAINTENANCE: NAME ADDRESS PHONE NO. CONTACT PLAN PREPARED BY: NAME ADDRESS PHONE NO. CERTIFICATION COMPANY SIGNATURE SAMUEL BELLOMIO WARE MALCOMB 3911 SORRENTO VALLEY BLVD SUITE 120 SAN DIEGO, CA 92121 858.638.7277 ACTIVE MOTIF GENERATOR 1914 PALOMAR OAKS WAY SUITE 150 CARLSBAD, CA 92008 waremalcomb.com 3911 sorrento valley blvd suite 120 san diego, ca 92121 p 858.638.7277 BEN SIEDCHLAG 760.431.1263 BMP NOTES: 1. THESE BMPS ARE MANDATORY TO BE INSTALLED PER MANUFACTURER'S RECOMMENDATIONS OR THESE PLANS. 2. NO CHANGES TO THE PROPOSED BMPS ON THIS SHEET WITHOUT PRIOR APPROVAL FROM THE CITY ENGINEER. 3. NO SUBSTITUTIONS TO THE MATERIAL OR TYPES OR PLANTING TYPES WITHOUT PRIOR APPROVAL FROM THE CITY ENGINEER. 4. NO OCCUPANCY WILL BE GRANTED UNTIL THE CITY INSPECTION STAFF HAS INSPECTED THIS PROJECT FOR APPROPRIATE BMP CONSTRUCTION AND INSTALLATION. 5. REFER TO MAINTENANCE AGREEMENT DOCUMENT. 6. SEE PROJECT SWMP FOR ADDITIONAL INFORMATION. BMP CONSTRUCTION AND INSPECTION NOTES: THE EOW WILL VERIFY THAT PERMANENT BMPS ARE CONSTRUCTED AND OPERATING IN COMPLIANCE WITH THE APPLICABLE REQUIREMENTS. PRIOR TO OCCUPANCY THE EOW MUST PROVIDE: 1. PHOTOGRAPHS OF THE INSTALLATION OF PERMANENT BMPS PRIOR TO CONSTRUCTION, DURING CONSTRUCTION, AND AT FINAL INSTALLATION. 2. A WET STAMPED LETTER VERIFYING THAT PERMANENT BMPS ARE CONSTRUCTED AND OPERATING PER THE REQUIREMENTS OF THE APPROVED PLANS. 3. PHOTOGRAPHS TO VERIFY THAT PERMANENT WATER QUALITY TREATMENT SIGNAGE HAS BEEN INSTALLED. PRIOR TO RELEASE OF SECURITIES, THE DEVELOPER IS RESPONSIBLE FOR ENSURING THE PERMANENT BMPS HAVE NOT BEEN REMOVED OR MODIFIED BY THE NEW HOMEOWNER OR HOA WITHOUT THE APPROVAL OF THE CITY ENGINEER. ACTIVE MOTIF REF. CBC2022-0161 DMA EXHIBIT ON \ --... I ) I I I \ I I I \ I I I \ I - The weighted runoff factor has been calcu lated per the City of Cars lbad Design Manual, Appendix B. C _ LC surface 1A s11rfa:cel + area-w e ighrer:t - Csurfac g2 A su1·fa:ce2 + LA au surfacils 0 □ The 1-year, 1-hollr design flow rate has been caculated per the City of Carlsbad Design Manual, Appendix J. t-----+----1-----11------+-----1------1-----+-----r--------t--------,------, Q1yr,1hr = C x 1ytr,1hr x A 1yr,1hr = 0.413 in/hr (per NOAA Atlas 14 Point Precipitation Frequency Estimates) I I I SCALE: 1" = 30' DATE INITIAL ENGINEER OF WORK I CJ CJ CJ BIO CLEAN FULL CAPTURE FILTER FOR USE INGRA TE INLETS ;r;: 7/7//: ~ ,.,,.,.,.,.,.,.,. '~ ~ ... ~ •• ... ... . . . •• . . . . . . . . . •• •• . . . y ._,.,.,.,.,.,..,.,. ~/r½ PLAN VIEW (GRATE NOT SHOWN) HIGH FLOW BYPASS I I //4/// ,I' ///j // OUTFLOW FLOW DIAGRAM INSTALLATION NOTES: TOP MOUNT PLATE MOUNT ANGLE 2" FLANGE 4• BYPASS CATCH ALTER CONCRETE GRATE INLET BOTTOM SCREEN MEETS FULL CAPTURE REQUIREMENTS 1. All HARDWARE, FLANGE, FRAME. SCREENS SHALL BE STAINLESS STEEL 2 OPTIONAL HYDROCARBON BOOM SHALL BE 2" DIAMETER. J. SEE PERFORMANCE REPORTS IN MANUFACTURES SPECIFICATIONS. 4. OTHER STANDARD AND CUSTOM MODEL SIZES AVAILABLE -CONTACT BIO CLEAN FOR MORE INFORMATION 5. BASED ON 37% OPEN AREA. 6. CONSIDERS A SAFETY FACTOR OF 2. 0. 7. CONSIDERS A LOCAL DEPRESSION PONDING DEPTH OF 6 INCHES. 8. STORAGE CAPACITY BASED ON THE BASKET HALF FULL 9. CONCRETE STRUCTURES SOLO SEPARATELY. NOT TO SCALE X / // , I I L ----_J ELEVATION VIEW MODEL I BIO-GRATE-FULL 72-72-12 BIO-GRATE -FULL 78-78-12 BIO-GRATE -FULL 24-24-12 BIO-GRATE-FULL 24-40-12 BIO-GRATE-FULL 24-24-24 BIO-GRATE-FULL 24-40-24 BIO-GRATE-FULL 36-36-24 TREATMENT FLOW RATE {CFS) 1.04 1.18 2.10 3.10 7.31 9.53 17.93 BYPASS FLOW (CFS) 7.24 2.19 4.96 6.35 4.96 6.35 1.14 ~ • ... SOLIDS STORAGE CAPACITY {CF) 0.15 0.33 0.59 0.88 1.22 1.82 2.13 PROPRIETARY AND CONFIDENTIAL: THE INFDRMA ffON cot{[AINEIJ IN THIS IX)CIJMENT JS THE SOI.£ PROPfRrf OF FOl?TERRA AND 175 COMPANIES. rHIS lXJC/JMENT, NOR ANY PAKT THEREOF, .u,iy BE USED, REPROD/JCED Of? UODIFIED IN ~y MANNER WITH our TH£ WRITTEN CONSENT OF FORrERRA. Bio-6-Clean GRATE INLET FILTER FULL CAPTURE STANDARD DETAIL "AS BUil T" WARE MALCOMB RCE EXP. DATE CIVIL ENGINEERING REVIEWED BY: REV. 112020 INSPECTOR DATE I SHEET I I SHEETS I CITY OF CARLSBAD ENGINEERING DEPARTMENT DWN BY: I PROJECT NO. II DRAWING NO.I DATE INITIAL DATE INITIAL CHKD BY: REVISION DESCRIPTION OTHER APPROVAL CITY APPROVAL RVWD BY: Attachment 1c NOAA ATLAS 14 POINT PRECIPITATION FREQUENCY ESTIMATES: CA Data description Data type: I Precipitation depth v I Units: I English v I Time series type: I Partial duration v I Select location 1) Manually: a) By location (decimal degrees, use ".' for S and W): Latitude: ~-----J Longitude: ~-----JI Submit I b) By station (list of CA stations): ~I S_e_l_e_ct_s_ta_t_o_n ______________ v~I c) By address I 1914 Palomar Oaks Way, Carlsbad, C XI Q. 2} Use map (if ESRI interactive map is not loading, try adding lhe host: https://js,arcgis.com/ to the firewa!J, or conlaci us at hdsc.questions@noaa.gov): 2km 1mi 1 " • j i:: a) Select location Move crosshair or double cli:k b) Click on station icon O Show stations on map Location infonnation: Name: Carlsbad, California, USA• LatittJde: 33.1249' Longiltlde: -117.2893' 'V\ Elevation: 230.87 ft*- • Source: ESRI Maps -Source: USGS ------ □: 11 11 I C II 11 11 I C II II II I D I 11 I I bl I 11 I 11 I II II I C l! II II I C II 11 I I C II II I C II 11 I C II II II I C II II II I D I 11 I I C II 11 I C II II I C II II II I C II 11 11 I C l! II II I D I II II I 30 C 25 ..r::. .µ c.. ~ 20 C 0 '.l:i I'll 15 ..... ·a u e 10 c.. 5 0 C -~ Ln 35 30 c 25 -..r::. .µ c.. ~ 20 C 0 ·~ 15 ..... :9, u e 10 c.. 0 1 PDS-based depth-duration-frequency (DDF) curves Latitude: 33.1249°, Lo ngitude: -117 .2893° -.. -:· .. -; .... -. ~ .. --. ~ .. -.. ~ ... ~. -. -. ~ .. -.. -;--.... ~ -.... ~ .. ·:-. ~. -.. ~ .. ·:· -... ' ' --.• -:--. -:-. -. -. ~ -... --: -. -.. -: --. ~ . -. -. -: -. -. --:--. -. -:--.. -. : . -. :-. -: . --. -: . -. :-.. -. - t ' • • ·••·,·••·r·••··r •·•··\·"·0 ·-.···,•·•··-.••·•··,·•·••·r···••r··•,·•-.· ----····-.. ··•··"······---·-.. --.•· • • t • • C: C: C C ... ... ... ... ... >, >, >, >, >, >, .E .E .E .E .c .c .c .c .c I'll I'll I'll I'll I'll I'll rlJ rf1 ,J;, I I " "" ,:, " " N ~ I I I I ,-I rlJ rf1 'St I I I 0 Ln 0 0 r--0 0 ,-I ,-I rrl \D ,-I N Duration ----. --:----. -. -. ---: -. ---. -. ~ -. -. --. ---. :-. ----. -. :- >, I'll " I 0 rrl 2 5 10 25 50 100 200 500 Average recurrence interval (years) >, >, I'll I'll "" I I LnO 'St\D 1000 NOAA Atlas 14, Volu me 6, Version 2 Created (GMT}: We-d Nov 9 17 :4 7:37 2022 Average recu1J0nc0 i11leiva'I (years} 1 2 15 10 25 50 100 200 500 1000 Duration 5-min 10-mln 15-mln 30-mn 60--fflln 2-tir 3-tir 6-tir 12-hr 24-hr 2--day 3--day 4--day 7--day 10-day 20-day 30-day 45-day 60-day .,- (f 0 "' '«~ :; ~ v1norv111e SAN,e-E. ,. RN,1 Riversi.de ti. ,\',9/'Yo . • . ~r-41, 8 h Anah~,n, Ca,lhedralt ity i\,(3 Long eac • •• . , •• • . Santa Ana ' a1mDesert Indio Oimard 0 Murriet,a • 7 Ensenada p """' <:' 8 4: ~ dZ^,WdhZ>h>d/KE^ D dKd>Z ;^&Ϳ Z ;Ϳ WZs/Kh^Z ;^&Ϳ /DWZs/Kh^Z ;^&Ϳ й/DWZs/Kh^  YϭLJƌͲϭŚƌ ;&^Ϳ DWdzW DK>EK͘ dZ^,WdhZ dZdDEd&>KtZd ;&^Ϳ ϭ ϵ͕ϰϴϲ Ϭ͘ϮϮ Ϯ͕ϬϳϮ ϳ͕ϰϭϰ ϳϴй Ϭ͘ϳϯ Ϭ͘Ϭϳ 'ƌĂƚĞ/ŶůĞƚ&ŝůƚĞƌ /KͲ'ZdͲ&h>> ϮϰͲϮϰͲϮϰ ϳ͘ϯϭ Ϯ ϯϭ͕ϰϱϴ Ϭ͘ϳϮ ϰ͕ϯϲϲ Ϯϳ͕ϬϵϮ ϴϲй Ϭ͘ϳϵ Ϭ͘Ϯϰ 'ƌĂƚĞ/ŶůĞƚ&ŝůƚĞƌ /KͲ'ZdͲ&h>> ϮϰͲϮϰͲϮϰ ϳ͘ϯϭ ϯ ϰϬ͕ϯϭϰ Ϭ͘ϵϯ ϭ͕ϲϲϰ ϯϴ͕ϲϱϬ ϵϲй Ϭ͘ϴϳ Ϭ͘ϯϯ 'ƌĂƚĞ/ŶůĞƚ&ŝůƚĞƌ /KͲ'ZdͲ&h>> ϮϰͲϮϰͲϮϰ ϳ͘ϯϭ ϰ Ϯ͕Ϭϰϯ Ϭ͘Ϭϱ Ϭ Ϯ͕Ϭϰϯ ϭϬϬй Ϭ͘ϵϬ Ϭ͘ϬϮ 'ƌĂƚĞ/ŶůĞƚ&ŝůƚĞƌ /KͲ'ZdͲ&h>> ϭϴͲϭϴͲϭϮ ϭ͘ϳϴ ^ƵƌĨĂĐĞdLJƉĞ ͲsĂůƵĞƐ Ϭ͘ϭ /ŵƉĞƌǀŝŽƵƐ^ƵƌĨĂĐĞ Ϭ͘ϵ dŚĞǁĞŝŐŚƚĞĚƌƵŶŽĨĨĨĂĐƚŽƌŚĂƐďĞĞŶĐĂůĐƵůĂƚĞĚƉĞƌƚŚĞŝƚLJŽĨĂƌƐůďĂĚĞƐŝŐŶDĂŶƵĂů͕ƉƉĞŶĚŝdž͘ dŚĞϭͲLJĞĂƌ͕ϭͲŚŽƵƌĚĞƐŝŐŶĨůŽǁƌĂƚĞŚĂƐďĞĞŶĐĂĐƵůĂƚĞĚƉĞƌƚŚĞŝƚLJŽĨĂƌůƐďĂĚĞƐŝŐŶDĂŶƵĂů͕ƉƉĞŶĚŝdž:͘ YϭLJƌ͕ϭŚƌсdžϭLJƌ͕ϭŚƌdž ϭLJƌ͕ϭŚƌсϬ͘ϰϭϯŝŶͬŚƌ;ƉĞƌEKƚůĂƐϭϰWŽŝŶƚWƌĞĐŝƉŝƚĂƚŝŽŶ&ƌĞƋƵĞŶĐLJƐƚŝŵĂƚĞƐͿ >ĂŶĚƐĐĂƉĞ Ca,·ea-weighted LC surface1A surface1 + Cs,,..face2A s111·face2 + CsurfacexA s111·facex LA all surfaces ENGINEERED SOLUTIONS Bio Clean® Catch Basin Inlet Filters Your Contech Team Contech is the leader in stormwater solutions, helping engineers, contractors and owners with infrastructure and land development projects throughout North America. With our responsive team of stormwater experts, local regulatory expertise and flexible solutions, Contech is the trusted partner you can count on for stormwater management solutions. The experts you need to solve your stormwater challenges STORMWATER CONSULTANT It’s my job to recommend the best solution to meet permitting requirements. STORMWATER DESIGN ENGINEER I work with consultants to design the best approved solution to meet your project’s needs. REGULATORY MANAGER I understand the local stormwater regulations and what solutions will be approved. SALES ENGINEER I make sure our solutions meet the needs of the contractor during construction. Contech is your partner in stormwater management solutions Bio Clean® Catch Basin Inlet Filter Configurations Bio Clean® Catch Basin Inlet Filter Advantages Removing trash and sediment to protect our waterways ... Our nation has some of the world’s most beautiful beaches and waterways. Unfortunately, trash such as cigarette butts, food packaging, cans and bottles, and plastic waste makes its way into streams, creeks, rivers, and the ocean, as rain events wash them into gutters and storm drains. Bio Clean Catch Basin Filters provide the first defense against trash and other pollutants entering your stormwater steam by providing 100% trash capture at the source, preventing system clogging and improving downstream water quality. Bio Clean Catch Basin Inlet Filters offer superior durability and customization ... 1-year warranty Long-lasting, stainless-steel construction Designed for a wide range of sizes to fit most curb and grate inlets High-flows bypass prevents scouring of previously captured trash and debris Installed and maintained in minutes Testing Highlight: California Water Board 100% of Trash Full Trash Capture Testing Highlight: Over 1,000 LBS of load capacity Standard Sediment Filter Testing Highlight: Third Party Testing 85% of TSS & 72% of TP Kraken® Membrane Filtration Designed for maximized flow rates while meeting trash full capture requirements by the State of California Water Board. Our filters provide easy access for maintenance from the surface without having to enter the catch basin. Maintenance service takes about 15 minutes and requires no confined space entry. Each Bio Clean Catch Basin Inlet Filter is designed to be insertable and the expandable trough system is designed to convey water quality design flows through the filter basket while allowing peak flows to bypass over the trough without resuspending captured pollutants. The modular design of the trough system makes it adaptable to any size* or type of curb inlet catch basin. *Some depth restrictions may apply. Bypass to prevent backflow during the largest storm events. Bio Clean® Catch Basin Inlet Filter Applications Bio Clean Catch Basin Inlet Filters have been successfully used on numerous new construction and retrofit projects. The system’s superior durability and customization make it ideal for a wide range of stormwater applications. Each filter fits within a shallow catch basin, giving them the ability to integrate with versatile curb inlet trough systems. Applications include: Parking Lot Curb Inlets Parking Lot Grate Inlets Roadway Curb Inlets Roadway Grate Inlets Bioswale Bypass Structures Stormwater Pretreatment Bypass Flow Path Treatment Flow Path Curb Opening Trough System Non-Clogging Screen Outflow Pipe Bypass Weir Bottom Screen Hydrocarbon Boom Rail Hydrocarbon Boom Captures 100% of trash ENGINEERED SOLUTIONS Full Trash Capture Full Capture Sizing Full Capture Removes 100% of Trash ... The Full Trash Capture catch basin inlet filter is California Full Capture approved and allows for a higher flow of water, making it more applicable for demanding applications. The screen has a specialized design that efficiently captures all trash, but also makes cleaning more efficient while maintaining its ability to meet demanding flow requirements. ENGINEERED SOLUTIONS MODEL #TREATMENT FLOW RATE (CFS) BYPASS FLOW RATE (CFS) STORAGE CAPACITY (CU FT) BIO-CURB-FULL-12 2.85 0.70 BIO-CURB-FULL-24 2.85 1.40 BIO-GRATE-FULL-12-12-12 1.04 1.24 0.15 BIO-GRATE-FULL-18-18-12 1.78 2.79 0.33 BIO-GRATE-FULL-24-24-12 2.70 4.96 0.59 BIO-GRATE-FULL-24-40-12 3.70 6.35 0.88 BIO-GRATE-FULL-24-24-24 7.31 4.96 1.22 BIO-GRATE-FULL-24-40-24 9.53 6.35 1.82 BIO-GRATE-FULL-36-36-24 11.93 7.74 2.73 Note: Flow rate includes safety factor of two for screen capacity. Storage capacity based on filter basket at 50% full. Bypass Flow Path Treatment Flow Path Mounting Flange High Flow Bypass Non-Clogging Screens Bottom Screen Hydrocarbon Boom (optional) Flow rate includes safety factor of two for screen capacity. Storage capacity based on filter basket at 50% full. Standard Sediment Filter The Standard Sediment Filter offers an affordable solution to capture trash and debris from stormwater before it enters the conveyance system. With a stainless-steel frame, the Standard Sediment Filter provided over 1000 lbs. of load capacity based in full scale load testing. Applications include: 100% of Trash Removal Over 1,000 LBS of Load Capacity Based in Full Scale Load Testing MODEL #TREATMENT FLOW RATE (CFS) BYPASS FLOW RATE (CFS) STORAGE CAPACITY (CU FT) BIO-CURB-FABRIC-12 2.85 0.70 BIO-CURB-FABRIC-24 2.85 1.40 BIO-GRATE-FABRIC-12-12-12 0.19 1.24 0.15 BIO-GRATE-FABRIC-18-18-12 0.32 2.79 0.35 BIO-GRATE-FABRIC-24-24-12 0.47 4.96 0.59 BIO-GRATE-FABRIC-24-40-12 0.64 6.35 0.88 BIO-GRATE-FABRIC-24-24-24 1.37 4.96 1.22 BIO-GRATE-FABRIC-24-40-24 1.78 6.35 1.82 BIO-GRATE-FABRIC-36-36-24 2.22 7.74 2.73 Standard Sediment Filter Sizing Built to last longer than other trash capture filters Bypass Flow Path Treatment Flow Path Mounting Flange High Flow Bypass Woven Geotextile Fabric Kr a k e n ® M e m b r a n e F i l t r a t i o n Kr a k e n ® F i l t e r T y p e S i z i n g EN G I N E E R E D S O L U T I O N S Ad v a n c e d - L e v e l F i l t r a t i o n . . . Th e K r a k e n C a t c h B a s i n I n s e r t i s a n a d v a n c e d f i l t r a t i o n d e v i c e de s i g n e d w i t h K r a k e n m e m b r a n e f i l t r a t i o n c a r t r i d g e s f o r i n c r e a s e d re m o v a l e f f i c i e n c i e s . K r a k e n F i l t e r c a r t r i d g e s a r e r e m o v a b l e a n d re u s a b l e a f t e r s p r a y c l e a n i n g w i t h a g a r d e n h o s e .  10 0 % o f T r a s h R e m o v a l  85 % R e m o v a l o f T S S  72 % R e m o v a l o f P h o s p h o r u s  81 % R e m o v a l o f O i l s & G r e a s e  52 % R e m o v a l o f C o p p e r  58 % R e m o v a l o f Z i n c  60 % R e m o v a l o f F e c a l C o l i f o r m EN G I N E E R E D S O L U T I O N S MO D E L # TR E A T M E N T F L O W RA T E ( C F S ) BY P A S S F L O W RA T E ( C F S ) BI O - C U R B - K M F - 3 3 0. 1 3 U N L I M I T E D BI O - G R A T E - K M F - 1 2 - 1 2 - 3 9 0. 0 4 0 . 5 2 BI O - G R A T E - K M F - 1 8 - 1 8 - 3 9 0. 0 4 2 . 5 1 BI O - G R A T E - K M F - 2 4 - 2 4 - 3 9 0. 1 7 5 . 3 1 BI O - G R A T E - K M F - 3 6 - 3 6 - 3 9 0. 5 1 2 . 5 3 BI O - G R A T E - K M F - 4 8 - 4 8 - 3 9 0. 8 8 1 7 . 0 5 By p a s s F l o w P a t h Tr e a t m e n t F l o w P a t h Kr a k e n Me m b r a n e Ca r t r i d g e s Ca r t r i d g e Ha n d l e Hi g h F l o w By p a s s Ca r t r i d g e Mo u n t No t e : F l o w r a t e b a s e d o n l o a d i n g r a t e o f 0 . 1 g p m / s q f t . S t o r a g e c a p a c i t y b a s e d o n f i l t e r b a s k e t a t 5 0 % f u l l . Al l m o d e l s a r e 3 0 ” t a l l t o a c c o m m o d a t e a f u l l s i z e K r a k e n C a r t r i d g e . EN GIN E E R E D SO LUTI ONS EN G I N E E R E D S O L U T I O N S tt © 2022 Contech Engineered Solutions LLC, a QUIKRETE Company All Rights Reserved. Printed in the USA. Few companies offer the wide range of high- quality stormwater resources you can find with us — state-of-the-art products, decades of expertise, and all the maintenance support you need to operate your system cost-effectively. Get social with us: 800-338-1122 |www.ContechES.com NOTHING IN THIS CATALOG SHOULD BE CONSTRUED AS A WARRANTY. APPLICATIONS SUGGESTED HEREIN ARE DESCRIBED ONLY TO HELP READERS MAKE THEIR OWN EVALUATIONS AND DECISIONS, AND ARE NEITHER GUARANTEES NOR WARRANTIES OF SUITABILITY FOR ANY APPLICATION. CONTECH MAKES NO WARRANTY WHATSOEVER, EXPRESS OR IMPLIED, RELATED TO THE APPLICATIONS, MATERIALS, COATINGS, OR PRODUCTS DISCUSSED HEREIN. ALL IMPLIED WARRANTIES OF MERCHANTABILITY AND ALL IMPLIED WARRANTIES OF FITNESS FOR ANY PARTICULAR PURPOSE ARE DISCLAIMED BY CONTECH. SEE CONTECH’S CONDITIONS OF SALE (AVAILABLE AT WWW.CONTECHES.COM/COS) FOR MORE INFORMATION. ENGINEERED SOLUTIONS THE CONTECH WAY Contech® Engineered Solutions provides innovative, cost-effective site solutions to engineers, contractors, and developers on projects across North America. Our portfolio includes bridges, drainage, erosion control, retaining wall, sanitary sewer and stormwater management products. TAKE THE NEXT STEP For more information: www.ContechES.com STORMWATER SOLUTIONS PIPE SOLUTIONS STRUCTURES SOLUTIONS Bio Clean® Catch Basin Inlet Filter Maintenance Filters can be maintained by a vac truck or by hand. ~ ~ ~ ~ l.:r\..l Ct')NTECH® rumaa PLAN VIEW (GRATE NOT SHOWN) ELEVATION VIEW FLOW DIAGRAM INSTALLATION NOTES: GRATE INLET FILTER FULL CAPTURE STANDARD DETAIL es a: ;i: ~ ~ ~ OCi BIO CLEAN FULL CAPTURE FILTER FOR USE INGRA TE INLETS OUTFLOW CATCH RLTER CONCRETE GRATE INLET NON-CLOGGING SCREEN MEETS FULL CAPTURE REQUIREMENTS BOTTOM SCREEN MEETS FULL CAPTURE REQUIREMENTS 1. ALL HARDWARE, FLANGE, FRAME, SCREENS SHALL BE STAINLESS STEEL. 2. OPTIONAL HYDROCARBON BOOM SHALL BE 2 n DIAMETER. 3. SEE PERFORMANCE REPORTS IN MANUFACTURES SPECIFICATIONS. 4. OTHER STANDARD AND CUSTOM MODEL SIZES AVAILABLE -CONTACT BIO CLEAN FOR MORE INFORMATION. 5. BASED ON 37% OPEN AREA. 6. CONSIDERS A SAFETY FACTOR OF 2.0. 7. CONSIDERS A LOCAL DEPRESSION PONDING DEPTH OF 6 INCHES. 8. STORAGE CAPACITY BASED ON THE BASKET HALF FULL. 9. CONCRETE STRUCTURES SOLD SEPARATELY. NOT TO SCALE L MODEL I BIO-GRATE-FULL 12-12-12 BIO-GRATE-FULL 18-18-12 BIO-GRATE-FULL 24-24-12 BIO-GRATE-FULL 24-40-12 BIO-GRATE-FULL 24-24-24 BIO-GRATE-FULL 24-40-24 BIO-GRATE-FULL 36-36-24 PROPRIETARY AND CONFIDENTIAL: Bio 6-Clean THE INFORMATION CONTNNED IN THIS DOCUMENT IS THE SOL£ PROPERTY OF FORT£RRA AND ITS COMPANIES. THIS DOCUMENT, NOR ANY PART TH£REOF, "4Y 8£ USED, R£PRODUC£D OR MOD/RED IN ANY "4NN£R WITH OUT THE WRITTEN CONSENT OF FORT£RRA. A Forllrrll Company TREATMENT FLOW RATE {CFS) 1.04 1.78 2.70 3.70 7.31 9.53 11.93 -.J ----,- BYPASS FLOW {CFS) 1.24 2.79 4.96 6.35 4.96 6.35 7.74 SOLIDS STORAGE CAPACITY {CF) 0.15 0.33 0.59 0.88 1.22 1.82 2.73 ENGINEERED SOLUTIONS Bio Clean® Grate Inlet Filter Operation & Maintenance Manual Bio~Clean· 2 Operation & Maintenance Contech’s Bio Clean® Grate Inlet Filter is a stormwater device designed to remove high levels of trash, debris, sediments DQGK\GURFDUERQV7KHÀOWHULVDYDLODEOHLQVHYHUDOFRQÀJXUDWLRQVLQFOXGLQJWUDVKIXOOFDSWXUH.UDNHQ® membrane ÀOWHUDQGIDEULFÀOWHUYDULDWLRQV7KLVPDQXDOFRYHUVPDLQWHQDQFHSURFHGXUHVRIWKHWUDVKIXOOFDSWXUHDQGIDEULFÀOWHU FRQÀJXUDWLRQV$VXSSOHPHQWDOPDQXDOLVDYDLODEOHIRUWKH.UDNHQYDULDWLRQ7KHWUDVKIXOOFDSWXUHÀOWHULVPDGHRI VWDLQOHVVVWHHOZKLOHWKHIDEULFÀOWHULVPDGHRIDZRYHQPRQRÀODPHQWJHRWH[WLOHIDEULF%RWKÀOWHUVDUHDYDLODEOHDW YDULRXVVL]HVDQGGHSWKVDOORZLQJWKHPWRÀWLQDQ\JUDWHGFDWFKEDVLQLQOHW7KHÀOWHUVKHDY\GXW\FRQVWUXFWLRQDOORZVIRU FOHDQLQJZLWKDQ\YDFXXPWUXFN7KHÀOWHUFDQDOVRHDVLO\EHFOHDQHGE\KDQG $VZLWKDOOVWRUPZDWHU%03VLQVSHFWLRQDQGPDLQWHQDQFHRQWKH*UDWH,QOHW)LOWHULVQHFHVVDU\6WRUPZDWHUUHJXODWLRQV UHTXLUH%03VEHLQVSHFWHGDQGPDLQWDLQHGWRHQVXUHWKH\DUHRSHUDWLQJDVGHVLJQHGWRDOORZIRUHIIHFWLYHSROOXWDQW UHPRYDODQGSURYLGHSURWHFWLRQWRUHFHLYLQJZDWHUERGLHV,WLVUHFRPPHQGHGWKDWLQVSHFWLRQVEHSHUIRUPHGPXOWLSOH WLPHVGXULQJWKHÀUVW\HDUWRDVVHVVVLWHVSHFLÀFORDGLQJFRQGLWLRQV7KLVLVUHFRPPHQGHGEHFDXVHSROOXWDQWORDGLQJFDQ YDU\JUHDWO\IURPVLWHWRVLWH9DULDEOHVVXFKDVQHDUE\VRLOHURVLRQRUFRQVWUXFWLRQVLWHVZLQWHUVDQGLQJRIURDGVDPRXQW RIGDLO\WUDIÀFDQGODQGXVHFDQLQFUHDVHSROOXWDQWORDGLQJRQWKHV\VWHP7KHÀUVW\HDURILQVSHFWLRQVFDQEHXVHGWR VHWLQVSHFWLRQDQGPDLQWHQDQFHLQWHUYDOVIRUVXEVHTXHQW\HDUV:LWKRXWDSSURSULDWHPDLQWHQDQFHD%03FDQH[FHHGLWV VWRUDJHFDSDFLW\ZKLFKFDQQHJDWLYHO\DIIHFWLWVFRQWLQXHGSHUIRUPDQFHLQUHPRYLQJDQGUHWDLQLQJFDSWXUHGSROOXWDQWV System DiagramSystem Diagram High Flow Bypass Hydrocarbon Boom Mounting Flange Grate Filter Basket Outlet Pipe Catch B a s i n 3 Inspection Equipment )ROORZLQJLVDOLVWRIHTXLSPHQWWRDOORZIRUVLPSOHDQGHIIHFWLYHLQVSHFWLRQRIWKH*UDWH,QOHW)LOWHU •&RQWHFK,QVSHFWLRQ)RUP FRQWDLQHGZLWKLQWKLVPDQXDO  •0DQKROHKRRNRUDSSURSULDWHWRROVWRUHPRYHDFFHVVKDWFKHVDQGFRYHUV •$SSURSULDWHWUDIÀFFRQWUROVLJQDJHDQGSURFHGXUHV •3URWHFWLYHFORWKLQJDQGH\HSURWHFWLRQ •1RWHHQWHULQJDFRQÀQHGVSDFHUHTXLUHVDSSURSULDWHVDIHW\DQGFHUWLÀFDWLRQ,WLVJHQHUDOO\QRWUHTXLUHGIRU URXWLQHLQVSHFWLRQVRUPDLQWHQDQFHRIWKHV\VWHP Inspection Steps 7KHFRUHWRDQ\VXFFHVVIXOVWRUPZDWHU%03PDLQWHQDQFHSURJUDPLVURXWLQHLQVSHFWLRQV7KHLQVSHFWLRQVWHSVUHTXLUHG RQWKH*UDWH,QOHW)LOWHUDUHTXLFNDQGHDV\$VPHQWLRQHGDERYHWKHÀUVW\HDUVKRXOGEHVHHQDVWKHPDLQWHQDQFHLQWHUYDO HVWDEOLVKPHQWSKDVH'XULQJWKHÀUVW\HDUPRUHIUHTXHQWLQVSHFWLRQVVKRXOGRFFXULQRUGHUWRJDWKHUORDGLQJGDWDDQG PDLQWHQDQFHUHTXLUHPHQWVIRUWKDWVSHFLÀFVLWH7KLVLQIRUPDWLRQFDQEHXVHGWRHVWDEOLVKDEDVHIRUORQJWHUPLQVSHFWLRQ DQGPDLQWHQDQFHLQWHUYDOUHTXLUHPHQWV 7KH*UDWH,QOHW)LOWHUFDQEHLQVSHFWHGWKRXJKYLVXDOREVHUYDWLRQ$OOQHFHVVDU\SUHLQVSHFWLRQVWHSVPXVWEHFDUULHGRXW EHIRUHLQVSHFWLRQRFFXUVVXFKDVVDIHW\PHDVXUHVWRSURWHFWWKHLQVSHFWRUDQGQHDUE\SHGHVWULDQVIURPDQ\GDQJHUV DVVRFLDWHGZLWKDQRSHQJUDWHGLQOHW2QFHWKHJUDWHKDVEHHQVDIHO\UHPRYHGWKHLQVSHFWLRQSURFHVVFDQSURFHHG •3UHSDUHWKHLQVSHFWLRQIRUPE\ZULWLQJLQWKHQHFHVVDU\LQIRUPDWLRQLQFOXGLQJSURMHFWQDPHORFDWLRQGDWH WLPH XQLWQXPEHUDQGRWKHULQIR VHHLQVSHFWLRQIRUP  •2EVHUYHWKHÀOWHUZLWKWKHJUDWHUHPRYHG •/RRNIRUDQ\RXWRIWKHRUGLQDU\REVWUXFWLRQVRQWKHJUDWHRULQWKHÀOWHUDQGLWVE\SDVV:ULWHGRZQDQ\ REVHUYDWLRQVRQWKHLQVSHFWLRQIRUP •7KURXJKREVHUYDWLRQDQGRUGLJLWDOSKRWRJUDSKVHVWLPDWHWKHDPRXQWRIWUDVKIROLDJHDQGVHGLPHQWDFFXPXODWHG LQVLGHWKHÀOWHUEDVNHW5HFRUGWKLVLQIRUPDWLRQRQWKHLQVSHFWLRQIRUP •2EVHUYHWKHFRQGLWLRQDQGFRORURIWKHK\GURFDUERQERRP5HFRUGWKLVLQIRUPDWLRQRQWKHLQVSHFWLRQIRUP •)LQDOL]HLQVSHFWLRQUHSRUWIRUDQDO\VLVE\WKHPDLQWHQDQFHPDQDJHUWRGHWHUPLQHLIPDLQWHQDQFHLVUHTXLUHG 4 Maintenance Indicators %DVHGXSRQREVHUYDWLRQVPDGHGXULQJLQVSHFWLRQPDLQWHQDQFHRIWKHV\VWHPPD\EHUHTXLUHGEDVHGRQ WKHIROORZLQJLQGLFDWRUV •0LVVLQJRUGDPDJHGLQWHUQDOFRPSRQHQWV •2EVWUXFWLRQVLQWKHÀOWHUEDVNHWDQGLWVE\SDVV •([FHVVLYHDFFXPXODWLRQRIWUDVKIROLDJHDQGVHGLPHQWLQWKHÀOWHUEDVNHW0DLQWHQDQFHLVUHTXLUHG ZKHQWKHEDVNHWLVJUHDWHUWKDQKDOIIXOO •7KHIROORZLQJFKDUWVKRZVWKHDQGVWRUDJHFDSDFLW\RIHDFKÀOWHUKHLJKW Maintenance Equipment ,WLVUHFRPPHQGHGWKDWDYDFXXPWUXFNEHXWLOL]HGWRPLQLPL]HWKHWLPHUHTXLUHGWRPDLQWDLQWKH&XUE,QOHW)LOWHUWKRXJK LWFDQHDVLO\EHFOHDQHGE\KDQG •&RQWHFK0DLQWHQDQFH)RUP FRQWDLQHGLQ2 00DQXDO  •0DQKROHKRRNRUDSSURSULDWHWRROVWRUHPRYHWKHJUDWH •$SSURSULDWHVDIHW\VLJQDJHDQGSURFHGXUHV •3URWHFWLYHFORWKLQJDQGH\HSURWHFWLRQ •1RWHHQWHULQJDFRQÀQHGVSDFHUHTXLUHVDSSURSULDWHVDIHW\DQGFHUWLÀFDWLRQ,WLVJHQHUDOO\QRWUHTXLUHGIRUURXWLQH PDLQWHQDQFHRIWKHV\VWHP6PDOORUODUJHYDFXXPWUXFN ZLWKSUHVVXUHZDVKHUDWWDFKPHQWSUHIHUUHG  %DVNHW0RGHO Height LQFKHV 7RS:LGWK LQFKHV 7RS/HQJWK LQFKHV %RWWRP:LGWK LQFKHV Bottom Length LQFKHV  6WRUDJH &DSDFLW\ &)  6WRUDJH &DSDFLW\ &) %,2*5$7()8// )$%5,&       %,2*5$7()8// )$%5,&       %,2*5$7()8// )$%5,&       %,2*5$7()8// )$%5,&     2.44 %,2*5$7()8// )$%5,&       %,2*5$7()8// )$%5,&     3.64 %,2*5$7()8// )$%5,&     5.46 %,2*5$7()8// )$%5,&     3.64 %,2*5$7()8// )$%5,&     5.46 5HIHUVWREDVNHWKHLJKWWRWDOV\VWHPKHLJKWLVHTXDOWREDVNHWKHLJKWSOXVLQFKHVIRUE\SDVV I I I I I 5 Maintenance Procedures ,WLVUHFRPPHQGHGWKDWPDLQWHQDQFHRFFXUVDWOHDVWWZRGD\VDIWHUWKHPRVWUHFHQWUDLQHYHQWWRDOORZGHEULVDQG VHGLPHQWVWRGU\RXW0DLQWDLQLQJWKHV\VWHPZKLOHÁRZVDUHVWLOOHQWHULQJLWZLOOLQFUHDVHWKHWLPHDQGFRPSOH[LW\ UHTXLUHGIRUPDLQWHQDQFH&OHDQLQJRIWKH*UDWH,QOHW)LOWHUFDQEHSHUIRUPHGXWLOL]LQJDYDFXXPWUXFN2QFHDOOVDIHW\ PHDVXUHVKDYHEHHQVHWXSFOHDQLQJRIWKH*UDWH,QOHW)LOWHUFDQSURFHHGDVIROORZHG •5HPRYHJUDWH WUDIÀFFRQWURODQGVDIHW\PHDVXUHVWREHFRPSOHWHGSULRU •8VLQJDQH[WHQVLRQRQDYDFXXPWUXFNSRVLWLRQWKHKRVHRYHUWKHRSHQHGFDWFKEDVLQ,QVHUWWKHYDFXXPKRVH GRZQLQWRWKHÀOWHUEDVNHWDQGVXFNRXWWUDVKIROLDJHDQGVHGLPHQW$SUHVVXUHZDVKLVUHFRPPHQGHGDQGZLOO DVVLVWLQVSUD\LQJRIIDQ\GHEULVVWXFNRQWKHVLGHRUERWWRPRIWKHÀOWHUEDVNHW3RZHUZDVKRIIWKHÀOWHUEDVNHW sides and bottom. •1H[WUHPRYHWKHK\GURFDUERQERRPWKDWLVDWWDFKHGWRWKHLQVLGHRIWKHÀOWHUEDVNHW7KHK\GURFDUERQERRPLV IDVWHQHGWRUDLOVRQWZRRSSRVLWHVLGHVRIWKHEDVNHW YHUWLFDOUDLOV $VVHVVWKHFRORUDQGFRQGLWLRQRIWKHERRP XVLQJWKHIROORZLQJLQIRUPDWLRQLQWKHQH[WEXOOHWSRLQW,IUHSODFHPHQWLVUHTXLUHGLQVWDOODQGIDVWHQRQDQHZ K\GURFDUERQERRP%RRPVFDQEHRUGHUHGGLUHFWO\IURPWKHPDQXIDFWXUHU •7KHIROORZLQJLVDUHSODFHPHQWLQGLFDWLRQFRORUFKDUWIRUWKHK\GURFDUERQERRPV •7KHODVWVWHSLVWRUHSODFHWKHJUDWHDQGUHPRYHDOOWUDIÀFFRQWURO •$OOUHPRYHGGHEULVDQGSROOXWDQWVVKDOOEHGLVSRVHGRIIROORZLQJORFDODQGVWDWHUHTXLUHPHQWV •'LVSRVDOUHTXLUHPHQWVIRUUHFRYHUHGSROOXWDQWVPD\YDU\GHSHQGLQJRQORFDOJXLGHOLQHV,QPRVWDUHDVWKHVHGLPHQW RQFHGHZDWHUHGFDQEHGLVSRVHGRILQDVDQLWDU\ODQGÀOO,WLVQRWDQWLFLSDWHGWKDWWKHVHGLPHQWZRXOGEHFODVVLÀHG DVKD]DUGRXVZDVWH •,QWKHFDVHRIGDPDJHGFRPSRQHQWVUHSODFHPHQWSDUWVFDQEHRUGHUHGIURPWKHPDQXIDFWXUHU+\GURFDUERQ ERRPVFDQDOVREHRUGHUHGGLUHFWO\IURPWKHPDQXIDFWXUHUDVSUHYLRXVO\QRWHG EXCELLENT CONDITION GOOD CONDITION MINIMAL CAPACITY REPLACEMENT REQUIRED 6 Maintenance Sequence 1. Remove grate and set up vacuum truck to clean the filter basket. 3. Remove the hydrocarbon boom that is attached to the inside of the filter basket. The hydrocarbon boom is fastened to rails on two opposite sides of the basket (vertical rails). Assess the color and condition of the boom using the information in the chart above. If replacement is required, install and fasten on a new hydrocarbon boom. 2. Insert the vacuum hose down into the filter basket and suck out debris. Use a pressure washer to assist in vacuum removal. Pressure wash off screens. 4. Close up and replace the grate and remove all traffic control. All removed debris and pollutants shall be disposed of following local and state requirements.  For Office Use Only (city) (Zip Code)(Reviewed By) Owner / Management Company (Date) Contact Phone ( )_ MP / MAemiT// etaD emaN rotcepsnI Weather Condition itiddA onal Notes Site Map # Long: Storm Event in Last 72-hours? No Yes GPS Coordinates of Insert Catch Basin Size Evidence of Illicit Discharge? Trash Accumulation Type of Inspection Routine Follow Up Complaint Storm Lat: Long: Lat: Long: Sediment Accumulation Office personnel to complete section to the left. Functioning Properly or Maintenance Needed? Comments: Foliage Accumulation Long: Lat: Long: Lat: 3 Lat: 2 1 Long: Inspection and Maintenance Report Catch Basin Only Signs of Structural Damage? 5 4 6 Lat: Lat: Lat: Long: 7 Lat: Long: 10 8 Long: Project Name Project Address 12 Lat: 11 Lat: Long: Long: ENGINEERED SOLUTIONS □ □ □ □ □ □ SUPPORT '5$:,1*6$1'63(&,),&$7,216$5($9$,/$%/($7:::&217(&+(6&20 © 2022 CONTECH ENGINEERED SOLUTIONS LLC, A QUIKRETE COMPANY 800-338-1122 WWW.CONTECHES.COM ALL RIGHTS RESERVED. PRINTED IN THE USA. CONTECH ENGINEERED SOLUTIONS LLC PROVIDES SITE SOLUTIONS FOR THE CIVIL ENGINEERING INDUSTRY. CONTECH’S PORTFOLIO INCLUDES BRIDGES, DRAINAGE, SANITARY SEWER, STORMWATER AND EARTH STABILIZATION PRODUCTS. FOR INFORMATION ON OTHER CONTECH DIVISION OFFERINGS, VISIT CONTECHES.COM OR CALL 800-338-1122. *UDWH,QOHW)LOWHU2SHUDWLRQ 0DLQWHQDQFH0DQXDO NOTHING IN THIS CATALOG SHOULD BE CONSTRUED AS A WARRANTY. APPLICATIONS SUGGESTED HEREIN ARE DESCRIBED ONLY TO HELP READERS MAKE THEIR OWN EVALUATIONS AND DECISIONS, AND ARE NEITHER GUARANTEES NOR WARRANTIES OF SUITABILITY FOR ANY APPLICATION. CONTECH MAKES NO WARRANTY WHATSOEVER, EXPRESS OR IMPLIED, RELATED TO THE APPLICATIONS, MATERIALS, COATINGS, OR PRODUCTS DISCUSSED HEREIN. ALL IMPLIED WARRANTIES OF MERCHANTABILITY AND ALL IMPLIED WARRANTIES OF FITNESS FOR ANY PARTICULAR PURPOSE ARE DISCLAIMED BY CONTECH. SEE CONTECH’S CONDITIONS OF SALE (AVAILABLE AT WWW.CONTECHES.COM/COS) FOR MORE INFORMATION. ENGINEERED SOLUTIONS ATTACHMENT 3 City standard Trash Capture BMP Exhibit [Use the City’s standard Trash Capture BMP Plan.] N79°41'14"E 3 7 0 . 0 8 ' N57°4 7 ' 4 8 " E 1 6 8 . 0 0 ' N0 2 ° 3 7 ' 0 1 " W 2 4 0 . 1 3 ' N83°48'29"E 274.72' N0 4 ° 5 9 ' 1 7 " W 15 . 3 4 ' N83°49'29"E 41.50' N59°3 7 ' 1 4 " E 1 0 2 . 0 6 ' N 3 2 ° 1 2 ' 1 2 " W 1 9 5 . 0 8 ' Δ = 0 1 ° 4 9 ' 2 6 " R = 7 3 6 . 0 0 ' L = 2 3 . 4 3 ' C L BMP-1 BIOCLEAN GRATE INLET FILTER BIO-GRATE-FULL 24-24-24 BMP-2 BIOCLEAN GRATE INLET FILTER BIO-GRATE-FULL 24-24-24 BMP-3 BIOCLEAN GRATE INLET FILTER BIO-GRATE-FULL 24-24-24 EXISTING COMMERC I A L BUILDING BMP-4 BIOCLEAN GRATE INLET FILTER BIO-GRATE-FULL 18-18-12 0 15 30 60 KEY IMPERVIOUS AREA BUILDING IMPERVIOUS AREA SURFACE FLOW PATH PERVIOUS AREA PROPERTY LINE DMA BOUNDARY WARE MALCOMB assumes no responsibility for utility locations. The utilities shown on this drawing have been plotted from the best available information. It is, however, the contractors responsibility to field verify the location of all utilities prior to the commencement of any construction. SOURCE CONTROL SOURCE CONTROL REQUIREMENT APPLIED IMPLEMENTATION SC-1 PREVENTION OF ILLICIT DISCHARGES YES USE OF EFFECTIVE IRRIGATION INCLUDES IN THE DESIGN AND UTILIZATION OF EXISTING RUNOFF COLLECTION POND FOR MONITORING RUNOFF AND REUSE SC-2 STORM DRAIN STENCILING OR SIGNAGE YES STENCIL EVERY INLET WITH PROHIBITIVE LANGUAGE "NO DUMPING! LEADS TO WATERWAYS" AND "NO CONTAMINE" IN SPANISH DMA EXHIBIT: SOIL GROUPS: THE SITE IS UNDERLAIN BY SOIL GROUP "B & D". NO EXISTING NATURAL HYDROLOGIC FEATURES NO CRITICAL COURSE SEDIMENT AREAS TO BE PROTECTED DEPTH TO GROUNDWATER EXPECTED TO BE OVER 20FT* FEATURES TO MINIMIZE IMPERVIOUSNESS: PAVEMENT WIDTHS ARE KEPT TO MINIMUM DESIGN STANDARDS SOURCE CONTROL SOURCE CONTROL REQUIREMENT APPLIED IMPLEMENTATION SD-3 MINIMIZE IMPERVIOUS AREA YES PAVEMENT WIDTHS ARE KEPT TO MINIMUM DESIGN STANDARDS. BMP TYPEBMP ID #SYMBOL CASQA NO.DRAWING NO.SHEET NO.(S)MAINTENANCEFREQUENCY TRASH CAPTURE BMP TABLE INSPECTION FREQUENCYQUANTITY TRASH CAPTURE BMPs 4 EA ** QUARTERLY1GRATE INLET FILTER QUARTERLY PARTY RESPONSIBLE FOR MAINTENANCE: NAME ADDRESS PHONE NO. CONTACT PLAN PREPARED BY: NAME ADDRESS PHONE NO. CERTIFICATION COMPANY SIGNATURE SAMUEL BELLOMIO WARE MALCOMB 3911 SORRENTO VALLEY BLVD SUITE 120 SAN DIEGO, CA 92121 858.638.7277 ACTIVE MOTIF GENERATOR 1914 PALOMAR OAKS WAY SUITE 150 CARLSBAD, CA 92008 waremalcomb.com 3911 sorrento valley blvd suite 120 san diego, ca 92121 p 858.638.7277 BEN SIEDCHLAG 760.431.1263 BMP NOTES: 1. THESE BMPS ARE MANDATORY TO BE INSTALLED PER MANUFACTURER'S RECOMMENDATIONS OR THESE PLANS. 2. NO CHANGES TO THE PROPOSED BMPS ON THIS SHEET WITHOUT PRIOR APPROVAL FROM THE CITY ENGINEER. 3. NO SUBSTITUTIONS TO THE MATERIAL OR TYPES OR PLANTING TYPES WITHOUT PRIOR APPROVAL FROM THE CITY ENGINEER. 4. NO OCCUPANCY WILL BE GRANTED UNTIL THE CITY INSPECTION STAFF HAS INSPECTED THIS PROJECT FOR APPROPRIATE BMP CONSTRUCTION AND INSTALLATION. 5. REFER TO MAINTENANCE AGREEMENT DOCUMENT. 6. SEE PROJECT SWMP FOR ADDITIONAL INFORMATION. BMP CONSTRUCTION AND INSPECTION NOTES: THE EOW WILL VERIFY THAT PERMANENT BMPS ARE CONSTRUCTED AND OPERATING IN COMPLIANCE WITH THE APPLICABLE REQUIREMENTS. PRIOR TO OCCUPANCY THE EOW MUST PROVIDE: 1. PHOTOGRAPHS OF THE INSTALLATION OF PERMANENT BMPS PRIOR TO CONSTRUCTION, DURING CONSTRUCTION, AND AT FINAL INSTALLATION. 2. A WET STAMPED LETTER VERIFYING THAT PERMANENT BMPS ARE CONSTRUCTED AND OPERATING PER THE REQUIREMENTS OF THE APPROVED PLANS. 3. PHOTOGRAPHS TO VERIFY THAT PERMANENT WATER QUALITY TREATMENT SIGNAGE HAS BEEN INSTALLED. PRIOR TO RELEASE OF SECURITIES, THE DEVELOPER IS RESPONSIBLE FOR ENSURING THE PERMANENT BMPS HAVE NOT BEEN REMOVED OR MODIFIED BY THE NEW HOMEOWNER OR HOA WITHOUT THE APPROVAL OF THE CITY ENGINEER. ACTIVE MOTIF 1 11 1 REF. CBC2022-0161 CD2022-0027 SINGLE SHEET BMP SITE PLAN N TURE \ --... I ) I I I \ I I I \ I I I \ I - • I I I SCALE: 1" = 30' 0 □ DATE INITIAL ENGINEER OF WORK I CJ CJ CJ BIO CLEAN FULL CAPTURE FILTER FOR USE INGRA TE INLETS ;r;: 7/7/// / ~ ~ ,.,.,.,.,.,.,.,.,.,.,.,.,.,. 1/,!'. ' .~ 0 "",.,.,,.,.,:,,.,.",. <I •, .. ' ~ ., . '. . ' . . '. ,, . '' .. ' . '. '• '• . '. y ._,.,.,.,.,.,.,.,. ~/r½ PLAN VIEW (GRATE NOT SHOWN) HIGH FLOW BYPASS I I //4/// ,I' ///j // OUTFLOW FLOW DIAGRAM INSTALLATION NOTES: TOP MOUNT PLATE MOUNT ANGLE 2" FLANGE 4• BYPASS CATCH ALTER CONCRETE GRATE INLET BOTTOM SCREEN MEETS FULL CAPTURE REQUIREMENTS 1. All HARDWARE, FLANGE, FRAME, SCREENS SHALL BE STAINLESS STEEL. 2. OPTIONAL HYDROCARBON BOOM SHALL BE 2" DIAMETER. J. SEE PERFORMANCE REPORTS IN MANUFACTURES SPECIFICATIONS. 4. OTHER STANDARD AND CUSTOM MODEL SIZES AVAILABLE -CONTACT BIO CLEAN FOR MORE INFORMATION. 5. BASED ON 37% OPEN AREA. 6. CONSIDERS A SAFETY FACTOR OF 2. 0. 7. CONSIDERS A LOCAL DEPRESSION PONDING DEPTH OF 6 INCHES. 8. STORAGE CAPACITY BASED ON THE BASKET HALF FULL. 9. CONCRETE STRUCTURES SOLO SEPARATELY. NOT TO SCALE X / // , I I L ----_J ELEVATION VIEW MODEL I BIO-GRATE-FULL 72-72-12 BIO-GRATE -FULL 78-78-12 BIO-GRATE -FULL 24-24-12 BIO-GRATE-FULL 24-40-12 BIO-GRATE-FULL 24-24-24 BIO-GRATE-FULL 24-40-24 BIO-GRATE-FULL 36-36-24 TREATMENT FLOW RATE {CFS) 1.04 1.18 2.10 3.10 7.31 9.53 17.93 BYPASS FLOW (CFS) 7.24 2.19 4.96 6.35 4.96 6.35 1.14 ~ • ... SOLIDS STORAGE CAPACITY {CF) 0.15 0.33 0.59 0.88 1.22 1.82 2.13 PROPRIETARY AND CONFIDENTIAL: THE INFDRMA ffON cot{[AINEIJ IN THIS IX)CIJMENT JS THE SOI.£ PROPfRrf OF FOl?TERRA AND 175 COMPANIES. rHIS lXJC/JMENT, NOR ANY PAKT THEREOF, .u,iy BE USED, REPROD/JCED Of? UODIFIED IN ~y MANNER WITH our TH£ WRITTEN CONSENT OF FORrERRA. Bio-6-Clean GRATE INLET FILTER FULL CAPTURE STANDARD DETAIL "AS BUil T" WARE MALCOMB RCE EXP. DATE CIVIL ENGINEERING REVIEWED BY: REV. 112020 INSPECTOR DATE I SHEETS I I SHEET I CITY OF CARLSBAD ENGINEERING DEPARTMENT DWN BY: I PROJECT NO. II DRAWING NO.I DATE INITIAL DATE INITIAL CHKD BY: REVISION DESCRIPTION OTHER APPROVAL CITY APPROVAL RVWD BY: